KEGG   Chlamydophila abortus: CAB214Help
Entry
CAB214            CDS       T00242                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cab  Chlamydophila abortus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAB214
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAB214
  Amino acid metabolism
   00310 Lysine degradation
    CAB214
Enzymes [BR:cab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAB214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
234569..235738
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGESGSGGLVVRWLKQVGENIAKDEPVIEVSTDKIATELASPKAGKLMRCLV
KEGDEVASGEIIALIDTECAVEEEVVVEEPSPHASCPQDSGKNAAWFSPAVLSLAHREGI
SIQQLQQISGTGNDGRVTRRDLENYILEMRQPSCPHIANANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLIAEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKTLADLSARSRANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggcgagtctggttctggagggttggtagttcgt
tggctcaagcaggtgggagagaacattgcaaaagatgagccggtaattgaagtatctact
gacaagattgctacagagttagcctcccctaaagcagggaaattaatgcgttgtctcgtc
aaagaaggtgatgaagttgcttccggagagattatagccttaatagatacggaatgtgct
gtcgaggaagaggtagttgtagaagaaccgtcacctcatgcttcttgtcctcaagattct
gggaagaatgcggcatggttttctccggcagttctgagtttagcacaccgtgaaggtatt
tctatccagcaactacagcagatttctggaacaggaaatgacggtcgtgtcacgcgtagg
gatttagaaaactacattcttgaaatgcgtcaaccttcgtgcccacatattgcgaatgcg
aatgaaaatcgtattcctatgtctccgctacgtagagctatagcttcctcgttatctaaa
tcttcagatgaagtgcctcatgcttctcttattgtggatattgatgtcacagatttgatg
aatttaattgctgaagagaaggatagattttttgccacgcatggtgtgaaactgacaatt
acgagtttcattatccagtgtttagcaaaagctttggagcaattcccgctattgaatggg
tctttagacggcgatacgattgttgtgaagaaatccatcaatgtgggtgtggctgtgaat
ttgaataaagagggcgttgttgttcctgttattcataattgtcaggatcgtggtttagta
agtattgcgaaaactcttgctgatctttctgcaagatctcgggcaaataaacttgatcct
tcagaaacgcaagatggtagtgttacggtgaccaattttggtatgacaggagctttaatt
ggcatgccgatcattcgttatcctgaagtcgctattttaggcataggaacgatacaaaaa
cgtgtggttgtgcgtgatgacgattctttagctattcgcaaaatggtgtatgttacccta
acatttgaccaccgggtacttgatggtatttacggtagtgaatttttaacctcattgaaa
aatcggttagagtctgttacgatgagctaa

DBGET integrated database retrieval system