KEGG   Chlamydia abortus S26/3: CAB214Help
Entry
CAB214            CDS       T00242                                 

Definition
(GenBank) putative lipoyl transferase protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cab  Chlamydia abortus S26/3
Pathway
cab00020  Citrate cycle (TCA cycle)
cab00310  Lysine degradation
cab01100  Metabolic pathways
cab01110  Biosynthesis of secondary metabolites
cab01120  Microbial metabolism in diverse environments
cab01130  Biosynthesis of antibiotics
cab01200  Carbon metabolism
Module
cab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAB214
  Amino acid metabolism
   00310 Lysine degradation
    CAB214
Enzymes [BR:cab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAB214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: CAH63671
UniProt: Q5L6Q0
Position
234569..235738
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGESGSGGLVVRWLKQVGENIAKDEPVIEVSTDKIATELASPKAGKLMRCLV
KEGDEVASGEIIALIDTECAVEEEVVVEEPSPHASCPQDSGKNAAWFSPAVLSLAHREGI
SIQQLQQISGTGNDGRVTRRDLENYILEMRQPSCPHIANANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLIAEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKTLADLSARSRANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggcgagtctggttctggagggttggtagttcgt
tggctcaagcaggtgggagagaacattgcaaaagatgagccggtaattgaagtatctact
gacaagattgctacagagttagcctcccctaaagcagggaaattaatgcgttgtctcgtc
aaagaaggtgatgaagttgcttccggagagattatagccttaatagatacggaatgtgct
gtcgaggaagaggtagttgtagaagaaccgtcacctcatgcttcttgtcctcaagattct
gggaagaatgcggcatggttttctccggcagttctgagtttagcacaccgtgaaggtatt
tctatccagcaactacagcagatttctggaacaggaaatgacggtcgtgtcacgcgtagg
gatttagaaaactacattcttgaaatgcgtcaaccttcgtgcccacatattgcgaatgcg
aatgaaaatcgtattcctatgtctccgctacgtagagctatagcttcctcgttatctaaa
tcttcagatgaagtgcctcatgcttctcttattgtggatattgatgtcacagatttgatg
aatttaattgctgaagagaaggatagattttttgccacgcatggtgtgaaactgacaatt
acgagtttcattatccagtgtttagcaaaagctttggagcaattcccgctattgaatggg
tctttagacggcgatacgattgttgtgaagaaatccatcaatgtgggtgtggctgtgaat
ttgaataaagagggcgttgttgttcctgttattcataattgtcaggatcgtggtttagta
agtattgcgaaaactcttgctgatctttctgcaagatctcgggcaaataaacttgatcct
tcagaaacgcaagatggtagtgttacggtgaccaattttggtatgacaggagctttaatt
ggcatgccgatcattcgttatcctgaagtcgctattttaggcataggaacgatacaaaaa
cgtgtggttgtgcgtgatgacgattctttagctattcgcaaaatggtgtatgttacccta
acatttgaccaccgggtacttgatggtatttacggtagtgaatttttaacctcattgaaa
aatcggttagagtctgttacgatgagctaa

DBGET integrated database retrieval system