KEGG   Chlamydophila abortus: CAB215Help
Entry
CAB215            CDS       T00242                                 

Definition
hypothetical protein
Orthology
K06041  
arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
cab  Chlamydophila abortus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
235769..236758
Genome map
AA seq 329 aa AA seqDB search
MRSPTTSIDLCQDIVSKQRESLERFFGAFQCEDTWVLAEKILHHQGSIFFSGVGKSGCIA
RKIVATLQSFGEHALFLASGDLLHGDLGVVRPGDIVCLFSKSGETRELLECIPYLKERGV
FIAGITSATYSSLAVLCDHVVILPMIEELDPFNLVPTTSTTCQLLFGDLLAITLLRSRQI
SLADYGKNHPGGQIGLKVIGKIRDYMFLKTEVPFCSPEDTIADSLDIFSSYGCGCVCIVN
EKFEILGIFTDGDLRRALARHGGDILSQRLQDVMTPNPRVISEDADVLLGLQMMETGSPV
TILPVVDAKDQKYVVGLLQMHTLAKAGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctcccacaacatctattgatctatgccaagatattgtcagtaagcaaagggaa
tctttagaacgtttttttggtgcttttcagtgtgaggatacttgggtattagctgagaag
atattacatcaccagggttcgatatttttttctggtgtaggaaaaagtggttgtatcgca
aggaaaatcgtcgctactttacagtcttttggagagcacgctcttttcctagcttctggc
gatctcctacacggggatcttggcgttgttcgtcctggagatatcgtctgtcttttttct
aagagtggagaaactcgcgagcttttagaatgtatcccttatttaaaggagcgaggcgta
tttattgcaggaattacctcagcgacttattcgagtttagccgttctttgtgatcacgtc
gttatcttacctatgatcgaagaattagatccttttaatcttgtgcctacaacatcaacg
acatgccaactactttttggtgatcttttagcgattactttattgcgtagtcggcaaatc
tctctcgctgattacgggaagaaccatccaggcggtcagattggtcttaaggttattggt
aaaattcgggattatatgttcctaaaaacagaagttcctttttgttctcctgaagacacc
atcgcagattctttggacatcttttcttcttatggttgtggctgtgtgtgtatagtgaac
gagaagtttgaaatattagggatcttcacagatggagatttacgcagagcattagcgcgt
catggaggcgatattctctctcagagacttcaagatgtcatgacaccaaatcctcgagtg
attagtgaagatgctgatgtgcttcttggcttacaaatgatggaaacagggagtcctgtg
accattttacccgtagtagatgctaaggatcagaagtatgtggtaggattgcttcagatg
cataccttggcaaaagcaggtctcatctaa

DBGET integrated database retrieval system