KEGG   Chlamydia abortus S26/3: CAB462Help
Entry
CAB462            CDS       T00242                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cab  Chlamydia abortus S26/3
Pathway
cab00010  Glycolysis / Gluconeogenesis
cab00020  Citrate cycle (TCA cycle)
cab00620  Pyruvate metabolism
cab01100  Metabolic pathways
cab01110  Biosynthesis of secondary metabolites
cab01120  Microbial metabolism in diverse environments
cab01130  Biosynthesis of antibiotics
cab01200  Carbon metabolism
Module
cab_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAB462 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CAB462 (pdhC)
   00620 Pyruvate metabolism
    CAB462 (pdhC)
Enzymes [BR:cab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CAB462 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CAH63915
UniProt: Q5L616
Position
complement(533565..534854)
Genome map
AA seq 429 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTATEEGWFRDCL
VKEGTKVQIGTPIAVISSEKDESFDLDHILPKTPEPELSIENVRLEEKEEVTKAQPYVAP
TQLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKERNLDISGIKGSGPGGRIVEKDL
DKAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASP
LLALLKELQVQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNTIVRFETIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKNLAAKAKSQSLKEEEYKGGSFCVSNLGMTGITAFT
AIINPPQAAILTVGSVQEEPVVINGEIIVGSTCILTLSIDHRVIDGYPAAMFMKRLQKIL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctccaaccatggaagtaggaacaatcgta
aaatggcataagaacaatggcgataagatagagtttggtgacgttctcttagaagtatcc
acagataaggctgtgctagaacacacggcaactgaagagggctggttccgggattgtctt
gttaaagagggaacaaaagtacagatcggcacacccatagctgtcatatcttctgagaag
gatgagtcttttgacttagatcatatccttcctaaaactcccgagccagaactttctata
gaaaatgtgcggctagaagaaaaagaagaagtcacgaaagcacaaccatacgttgcccct
acgcagctagcctttcaatttaaacctgaacctcctctgtctaaacctctatctttaaaa
gtagattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaagaaac
ctggatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctg
gataaagctcctaccaaaggtattgccggttttggttaccctgaagctcctgaagtgcat
cctggatcctatcacgaggaaactctttctcctattcgagatatcattgcacagaggcta
caagctgcaaaagcctctattccacatttttatgtaacacaaaaagtgtatgcttcgccg
ttacttgccttacttaaagaattacaggtccaaggaattaagctgtctattaatgactgt
attgttcgtgcttgcgccttagctttaaaagagtttcctgaagtcaattcaggtttcaat
agcgtcgataataccattgtacgttttgaaactatcgatatttcaattgctgtggctatt
cctgatggtgtgatcacgcctattgtacgctgtgctgaccgtaagaatataggtatgatt
tctgccgagattaaaaacttagctgctaaagctaaatctcaatctttaaaagaggaagag
tataaaggcgggtctttctgtgtttccaatttaggcatgacgggaattaccgcattcaca
gccattatcaatccccctcaagcagctattcttactgtaggtagtgttcaagaagagcct
gtagttatcaatggagagattatagttggttctacatgtatattgacattatctatagat
caccgtgtgattgacggatatcctgcagccatgtttatgaaacgattacagaaaatttta
gaagctccttctgtccttttattaaattaa

DBGET integrated database retrieval system