KEGG   Chlamydia abortus S26/3: CAB469Help
Entry
CAB469            CDS       T00242                                 

Gene name
recR
Definition
(GenBank) recombination protein
  KO
K06187  recombination protein RecR
Organism
cab  Chlamydia abortus S26/3
Pathway
cab03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CAB469 (recR)
DNA repair and recombination proteins [BR:cab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CAB469 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CAB469 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 Toprim RecR HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: CAH63922
UniProt: Q5L609
Position
complement(542362..542964)
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYLSKLISLLRKLPGIGFKTAEKLAFELLDWDKDQLESMGKAFSELSAARSHCPT
CFCLKSHPESVCSFCQNNRDTSILCIVATPKDIFSLERSQIFQGHYYVLGALLSPITGRH
IDAERMHLLKQRIEFLKPKEIILALDATLEGDATALFLKQELSHSSASVSRLALGLPIGL
SFDYIDSGTLARAFSGRNPY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtatcctgactatttatccaaactcatctctttgcttagaaaacttcctgga
ataggatttaaaacagcagaaaaactcgcttttgaattattggattgggataaggatcaa
ttagaatctatggggaaagctttttctgagctctctgctgcacgcagccattgtcccacg
tgtttttgcttaaaaagtcatccagaaagcgtgtgctcattttgtcaaaacaatcgagac
acgtctatattgtgtatcgtagcaactcctaaagatattttttctttagaacgctcccaa
attttccaaggtcactattatgtcttaggagccttactatcgccaataacgggaagacat
atcgatgcagaaagaatgcatttactaaaacaacgtatagaatttttaaaaccaaaagaa
attattttagctctggacgccactctagaaggagatgctacggctcttttcttaaaacaa
gaactttcccattcttccgcctcagtttctcgtttagctctaggtttgcctataggattg
tcttttgattatatagactctgggacacttgctagagccttttctggaagaaacccatat
taa

DBGET integrated database retrieval system