KEGG   Chlamydophila abortus: CAB581Help
Entry
CAB581            CDS       T00242                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cab  Chlamydophila abortus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAB581
   01230 Biosynthesis of amino acids
    CAB581
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAB581
   00030 Pentose phosphate pathway
    CAB581
   00051 Fructose and mannose metabolism
    CAB581
   00052 Galactose metabolism
    CAB581
  Energy metabolism
   00680 Methane metabolism
    CAB581
Enzymes [BR:cab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CAB581
Protein phosphatases and associated proteins [BR:cab01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CAB581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
659209..660867
Genome map
AA seq 552 aa AA seqDB search
MQSNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTPDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TIEITEEFMECFKNSGGFNCIGTGRTNIITEENKAVCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEHADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFVKFKLYRKIWALEDSYRVLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgaactccaatgatctcaatgacgtagttatcccaggcaccccgccactcccc
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgcgaagcttttccctaatacctatgacagtccttacctaaaattt
acttcaggaactcctgaccaacctgttcgcccactaaaagtcggtgtgatgctatcggga
ggtcccgctcccggaggtcataacgttatttggggattacttcacagcttaaagaaaatt
catcccgacagttcgctcatcggttttcttaataacggccaggggattctaaataatcat
acaatagaaattaccgaagaattcatggagtgtttcaaaaattccggaggattcaactgc
ataggcacaggaagaacaaatatcatcacggaagaaaataaagctgtatgtttaaaaaca
gtacaggctttagacctggatggtttggtcattattggcggtgatggttcgaatacagca
actgctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgtc
cctaaaactattgatggtgatcttcaacacctatttttagacctcacctttggatttgat
tcagcaacaaaattctattcctcgattattagcaacatttctagagatacgctatcttgc
aaagcgcattaccacgtgatcaagctgatgggccgctctgcatcgcacattgctttagaa
tgcactctacaaacacatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gttcctctaaatacgatcatccataaagtctgttccatcattgctgatagagccgctatg
gggaaatactacggcatcattcttattcctgaaggcattatcgaattcatccccgagatt
aacaacctggtgaaagaaatcgaaagaatccctgagcatgctgataaattttcttctcta
tcccgagaatctcaaaaattactaaaaagcttcccggaaactatcgctaaacaactcctg
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccacctcgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcctgcttaccaacaaaattcgataatacctac
agctacgccttaggctatggcgcaggagttcttacttataatcgctgcaacggctacctc
actgtcatcgaatcacttatcaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaaaaag
agtttaattgatattagcagtcctgcttttgtgaagtttaaactctatagaaagatatgg
gctctagaagattcttatcgtgttttaggaccattacagattgacaccccaccaaactct
cattccgatcattttcctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaatccctgactgtgattattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system