KEGG   Chlamydophila abortus: CAB585Help
Entry
CAB585            CDS       T00242                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cab  Chlamydophila abortus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cab00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAB585 (leuS)
Enzymes [BR:cab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     CAB585 (leuS)
Amino acid related enzymes [BR:cab01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CAB585 (leuS)
Transfer RNA biogenesis [BR:cab03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CAB585 (leuS)
 Prokaryotic Type
    CAB585 (leuS)
Mitochondrial biogenesis [BR:cab03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CAB585 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(665009..667471)
Genome map
AA seq 820 aa AA seqDB search
MRYDPSLIEKKWQQFWKEHKSFKADETADKPKYYVLDMFPYPSGAGLHVGHLIGYTATDI
VARYKRAKGFSVLHPMGWDSFGLPAEQYAVRTGTHPRETTKKNIENFRKQLSAMGFSYDE
AREFATSDPEYYRWTQKLFLFLYEKGLAYMADMAVNYCEELGTVLANEEVENGLSIEGGY
PVERRMLRQWILRITAYADQLLQGLEDLDWPENVKQLQRNWIGKSEGALLRFVVDKDKCL
EVFTTRPDTLCGVSFLVMAPEHPEIQQLVSEEQRSAVESYIRCAQSKSERERISETKVKS
GVFTGAYAKHAITGAALPIWVSDYVIMGYGSGVVMGVPAHDERDREFANAFALPIDEVLD
ENEHCINSNHGDFLLNGLQGKEASDYVIAYLQKRNLGEAKVMYKLHDWLFSRQRYWGEPI
PIIHFEDGTCRPLEDDELPLLPPEIQDYRPKGFGQGPLAKVKEWVDIHDVKTQRPGRRET
HTMPQWAGSCWYYLRFCDAHNSQAPWSHENERYWMPVDLYIGGAEHAVLHLLYSRFWHRV
FYEAGLVSTPEPFKKLINQGLVLATSYRIPGKGYVHPEDAREDNGKWTTASGEELEVRQE
KMSKSKLNGVDPQILIDEFGADALRMYAMFSGPLDKNKLWCNQGVSGCRRFLNRFYELAT
SSAVQDIDDPKGMALAHRLVHKVGEDIEKMSLNTIPSSFMEFINEFAKLDTYSKSALSMV
VRALAPIAPHISEELWTVLGYAPGIDNAGWPEVDPKYLEDTSVTFVIQVNGKLRARLDMD
KNTSQEDILSAARESVAKYLEDKEIKKEVFVPNRLVNFVL
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcggtacgatcctagtttaatagaaaagaagtggcagcaattttggaaggaacacaaa
agctttaaggcagacgaaactgccgataagcctaaatattatgtattggacatgttccct
tatccttctggagccggcctgcatgtcggacatctcataggttataccgctacagacatt
gtcgcacgctataagagggctaagggattttcagttctacatcctatgggttgggatagt
tttggcttgcctgcagaacaatatgcagttagaacaggaacacatcctagggaaactaca
aaaaagaatatagagaattttagaaagcaactttcagctatgggattttcctatgacgag
gcgagagagtttgctactagtgaccctgagtactatcgttggactcaaaaactctttctc
tttttgtatgaaaaggggctggcctatatggcagatatggcagtcaactattgtgaagag
ttagggactgttttagctaatgaagaagtagagaatggtttatccatagagggagggtat
cccgtagagcgtagaatgttgcgccagtggattttacgtattacagcgtatgcagatcag
ctattgcagggtttagaggatttagattggccagaaaacgtcaaacagcttcaaagaaat
tggatagggaagtcagaaggggctctcctacgttttgtagtagataaagacaagtgttta
gaagtatttactacacgtcccgataccctatgtggtgtatcgtttctcgtcatggctcca
gaacatcctgagatacagcaactcgtttctgaggaacaacgtagtgctgtagaaagctat
attcgctgtgcacaaagtaaaagcgaacgtgaacgtataagtgaaactaaggtaaaaagc
ggagtatttacaggagcctatgctaagcacgcgatcacaggtgctgctttacctatctgg
gtttccgattacgtgatcatgggatatggttccggagtggtgatgggcgtccctgctcat
gatgagagagacagagagtttgctaacgcatttgctctacctattgatgaggttctcgat
gaaaatgaacattgtatcaatagtaaccatggggattttcttctcaacggcctgcaaggc
aaagaagctagcgattatgtgattgcttatttgcaaaagaggaatttgggagaagctaaa
gtgatgtataagctgcatgattggctattttctcgccaaaggtattggggagagccaatt
cccattattcattttgaagatgggacatgccgtcctttagaagatgatgaacttccttta
ctgcctcccgaaattcaagactaccgccccaagggttttggtcaagggcccttggcaaag
gtaaaagagtgggtagatattcatgatgtaaagactcagcgtccgggaagacgtgaaaca
catactatgcctcagtgggcaggatcttgctggtattacttgcgtttttgtgatgcgcat
aattctcaagcaccttggtctcatgaaaatgaacgctactggatgcctgtggatctgtat
attggaggtgcagaacacgcggttttgcacttactatattctcgcttttggcatcgggtg
ttttatgaagccggcttggtctcgacgccagaaccctttaaaaagttaatcaatcaaggt
ttagttcttgcgacatcgtaccggattcctggtaaggggtatgttcaccctgaagatgct
cgagaggataacggcaaatggacaacggcttctggagaagaattagaagtccgtcaggaa
aagatgtcgaagtctaagttaaatggagtggatcctcaaatcctaatagatgagttcgga
gctgatgcgttgcgtatgtatgcgatgttttcaggaccgttagataaaaacaagctgtgg
tgtaatcagggtgtttcaggctgtaggcgctttttaaatcgtttttatgagttagctact
tcatctgctgttcaagatattgatgatcctaagggaatggctcttgcgcacagactcgta
cataaggttggggaagatatagaaaaaatgtctttaaatacgataccatcttcttttatg
gaattcatcaatgaattcgcaaagcttgatacttattctaaatctgctttgtctatggtt
gtgcgtgctttagctcctatagctcctcatatcagtgaggaattgtggacagttttgggc
tacgctcccggtatcgacaatgcagggtggccagaagtagacccgaaatatttagaagat
acttccgtaacatttgtaatacaggtcaatggaaagttaagagcgcgtttagatatggat
aagaacacttcacaagaagacatcttgtccgcagcaagagagtccgtcgctaaatatcta
gaagataaagaaattaaaaaagaagtttttgttcctaatagattggtgaatttcgttcta
tga

DBGET integrated database retrieval system