KEGG   Chlamydophila abortus: CAB585Help
Entry
CAB585            CDS       T00242                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cab  Chlamydophila abortus
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cab00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(665009..667471)
Genome map
AA seq 820 aa AA seqDB search
MRYDPSLIEKKWQQFWKEHKSFKADETADKPKYYVLDMFPYPSGAGLHVGHLIGYTATDI
VARYKRAKGFSVLHPMGWDSFGLPAEQYAVRTGTHPRETTKKNIENFRKQLSAMGFSYDE
AREFATSDPEYYRWTQKLFLFLYEKGLAYMADMAVNYCEELGTVLANEEVENGLSIEGGY
PVERRMLRQWILRITAYADQLLQGLEDLDWPENVKQLQRNWIGKSEGALLRFVVDKDKCL
EVFTTRPDTLCGVSFLVMAPEHPEIQQLVSEEQRSAVESYIRCAQSKSERERISETKVKS
GVFTGAYAKHAITGAALPIWVSDYVIMGYGSGVVMGVPAHDERDREFANAFALPIDEVLD
ENEHCINSNHGDFLLNGLQGKEASDYVIAYLQKRNLGEAKVMYKLHDWLFSRQRYWGEPI
PIIHFEDGTCRPLEDDELPLLPPEIQDYRPKGFGQGPLAKVKEWVDIHDVKTQRPGRRET
HTMPQWAGSCWYYLRFCDAHNSQAPWSHENERYWMPVDLYIGGAEHAVLHLLYSRFWHRV
FYEAGLVSTPEPFKKLINQGLVLATSYRIPGKGYVHPEDAREDNGKWTTASGEELEVRQE
KMSKSKLNGVDPQILIDEFGADALRMYAMFSGPLDKNKLWCNQGVSGCRRFLNRFYELAT
SSAVQDIDDPKGMALAHRLVHKVGEDIEKMSLNTIPSSFMEFINEFAKLDTYSKSALSMV
VRALAPIAPHISEELWTVLGYAPGIDNAGWPEVDPKYLEDTSVTFVIQVNGKLRARLDMD
KNTSQEDILSAARESVAKYLEDKEIKKEVFVPNRLVNFVL
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcggtacgatcctagtttaatagaaaagaagtggcagcaattttggaaggaacacaaa
agctttaaggcagacgaaactgccgataagcctaaatattatgtattggacatgttccct
tatccttctggagccggcctgcatgtcggacatctcataggttataccgctacagacatt
gtcgcacgctataagagggctaagggattttcagttctacatcctatgggttgggatagt
tttggcttgcctgcagaacaatatgcagttagaacaggaacacatcctagggaaactaca
aaaaagaatatagagaattttagaaagcaactttcagctatgggattttcctatgacgag
gcgagagagtttgctactagtgaccctgagtactatcgttggactcaaaaactctttctc
tttttgtatgaaaaggggctggcctatatggcagatatggcagtcaactattgtgaagag
ttagggactgttttagctaatgaagaagtagagaatggtttatccatagagggagggtat
cccgtagagcgtagaatgttgcgccagtggattttacgtattacagcgtatgcagatcag
ctattgcagggtttagaggatttagattggccagaaaacgtcaaacagcttcaaagaaat
tggatagggaagtcagaaggggctctcctacgttttgtagtagataaagacaagtgttta
gaagtatttactacacgtcccgataccctatgtggtgtatcgtttctcgtcatggctcca
gaacatcctgagatacagcaactcgtttctgaggaacaacgtagtgctgtagaaagctat
attcgctgtgcacaaagtaaaagcgaacgtgaacgtataagtgaaactaaggtaaaaagc
ggagtatttacaggagcctatgctaagcacgcgatcacaggtgctgctttacctatctgg
gtttccgattacgtgatcatgggatatggttccggagtggtgatgggcgtccctgctcat
gatgagagagacagagagtttgctaacgcatttgctctacctattgatgaggttctcgat
gaaaatgaacattgtatcaatagtaaccatggggattttcttctcaacggcctgcaaggc
aaagaagctagcgattatgtgattgcttatttgcaaaagaggaatttgggagaagctaaa
gtgatgtataagctgcatgattggctattttctcgccaaaggtattggggagagccaatt
cccattattcattttgaagatgggacatgccgtcctttagaagatgatgaacttccttta
ctgcctcccgaaattcaagactaccgccccaagggttttggtcaagggcccttggcaaag
gtaaaagagtgggtagatattcatgatgtaaagactcagcgtccgggaagacgtgaaaca
catactatgcctcagtgggcaggatcttgctggtattacttgcgtttttgtgatgcgcat
aattctcaagcaccttggtctcatgaaaatgaacgctactggatgcctgtggatctgtat
attggaggtgcagaacacgcggttttgcacttactatattctcgcttttggcatcgggtg
ttttatgaagccggcttggtctcgacgccagaaccctttaaaaagttaatcaatcaaggt
ttagttcttgcgacatcgtaccggattcctggtaaggggtatgttcaccctgaagatgct
cgagaggataacggcaaatggacaacggcttctggagaagaattagaagtccgtcaggaa
aagatgtcgaagtctaagttaaatggagtggatcctcaaatcctaatagatgagttcgga
gctgatgcgttgcgtatgtatgcgatgttttcaggaccgttagataaaaacaagctgtgg
tgtaatcagggtgtttcaggctgtaggcgctttttaaatcgtttttatgagttagctact
tcatctgctgttcaagatattgatgatcctaagggaatggctcttgcgcacagactcgta
cataaggttggggaagatatagaaaaaatgtctttaaatacgataccatcttcttttatg
gaattcatcaatgaattcgcaaagcttgatacttattctaaatctgctttgtctatggtt
gtgcgtgctttagctcctatagctcctcatatcagtgaggaattgtggacagttttgggc
tacgctcccggtatcgacaatgcagggtggccagaagtagacccgaaatatttagaagat
acttccgtaacatttgtaatacaggtcaatggaaagttaagagcgcgtttagatatggat
aagaacacttcacaagaagacatcttgtccgcagcaagagagtccgtcgctaaatatcta
gaagataaagaaattaaaaaagaagtttttgttcctaatagattggtgaatttcgttcta
tga

DBGET integrated database retrieval system