KEGG   Chlamydophila abortus: CAB621Help
Entry
CAB621            CDS       T00242                                 

Definition
exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cab  Chlamydophila abortus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CAB621
Enzymes [BR:cab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CAB621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
712482..714680
Genome map
AA seq 732 aa AA seqDB search
MEKISGKLESVLFEDHDSKETAARMRIPYKGTMIVIKGQFPDSFLQLGMQLHLYGKWSEN
PHLGKYFQVYSCDSQEMRDNRGIINYLTSRLIKGIGPKITEKIIEKFRNDTADILDNQPE
RLIEIPGISQTRCDSLCEQLREQKNLRTTLLFLQQYNIAIHYGVKIYKKYKENSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLCAGIQYSLEELQEDGHTCYPLQSLAQ
LVEKLLNQDIPEKLIRIEEIISQVYTMQEKNLLHIQELENTPYVWAKHIYLAEKTVVSDL
KRILFSSRKIRPIDSNKAIQWVEENLSIHLEHNQKEAIRACFSEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHVIVIFIGDVHQLPSIGPGNILKDIINSKKITV
TQLNKIFRQVHDSNIIINAHKVNEGEFPILYSESGRKDFLFFQKEDPQEAVDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGVLGIHNLNRVLKSALNPKQATLHGRFHSYAVGDKVMQI
RNNYNKEIFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIILPIHTSHFMMLYRNLLYTAITRGKQLVVLVGTKKAIAIATRNDKVQHRCTGLLQA
LEQLTQPQSSGT
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaagcgtgctttttgaagatcatgattcaaaggaa
actgctgcacgcatgagaataccctacaagggtaccatgatcgttatcaaaggacaattc
cccgattcttttttgcagctcggtatgcaactacatctatacggcaagtggtcagaaaat
ccccacctagggaagtacttccaagtatatagttgtgattctcaagaaatgcgggataat
cgcgggataatcaactaccttacctctagacttatcaaaggcatcgggccaaaaattaca
gaaaaaatcatcgagaaattccgaaatgacaccgcagatattctcgataatcaacccgaa
agattaatagaaatcccagggattagtcaaacgcgctgtgatagcctctgcgaacaacta
cgcgaacaaaaaaatcttcggacgacattactcttcctacaacagtacaacattgccatt
cattatggtgtaaaaatctataaaaagtataaagagaactccatagaaaaaatatgtgaa
gatccttttcttcttgctagagaaatggaagggatcggatttaaaactgctgatcttata
gcaacacgtcttggtgtacctttaaactcacaaagccgattatgtgctggcatacagtat
tctctggaagaactccaagaagatggtcatacttgctaccccttacaaagtctggctcag
ttagtagagaaactactcaatcaagatattccagaaaaactcatacgcattgaagaaatc
atttctcaagtgtacaccatgcaagagaaaaatcttcttcacatccaagagttagaaaac
actccgtacgtatgggcaaagcatatttacctagcagaaaaaacagtagtttctgattta
aaacgcattttattttcctcaagaaaaatccgccctatagatagcaacaaagccattcaa
tgggttgaggaaaatttaagtatacatttagagcacaaccagaaagaagctattcgtgcg
tgtttttcggaaaaaattcacatcattactggaggaccgggaacagggaaaagtacgatc
actaaggctatactcaagatatttgagcaagtgacttataaaatcattttagcggctcct
acagggaaagctgcaaaacgcatgacagaaattactggaaaacactcagtaactatccat
gctctgttacaatacgactttaaaacacggtctttccgtaagaactatgaaaaccctata
gattgcgatctgatcattgtcgatgaatctggaatgatggatacctatcttttgtatcat
ttcttaaaagctcttcctgatcatgtgatcgtgatattcattggagatgtacatcaactt
ccgagtattggccctggcaatatcctcaaagatattatcaattctaaaaagattaccgta
acgcagctaaataagattttccgtcaggtccacgactccaacatcattatcaatgcccat
aaagtcaatgaaggtgagttccctatcttatattctgaatctggccggaaagatttccta
tttttccaaaaagaagatcctcaagaagctgtggaccatattgtccatctagtgacacag
ttcatccctaagaaataccatatctatcccaaagatattcaaattcttgctccaatgaaa
aagggtgtcctaggaattcataatcttaatagagtcttaaaatccgctttaaatcctaag
caggctactctccacgggagatttcattcctatgctgtaggagataaggtcatgcaaatc
cgcaacaactataataaagaaatatttaatggagatattggttatatctctatgattaac
tttgaaaataagcgcgttgtagtcaacatggaaggcaagtatgtcgtctattccttttct
gagcttgatgatctggttttagcctatgctacctcagtgcataaataccaaggaagtgaa
agtccgtgcattatcctacctatacacacttcacattttatgatgctgtacaggaatcta
ctctacacagccatcactagggggaaacaactcgtcgtcttagtcggaacgaaaaaagct
attgctatagccacaagaaatgataaagtgcaacaccgctgtacgggactcttacaagcc
cttgaacaactgactcaaccccaatcgtcaggaacatga

DBGET integrated database retrieval system