KEGG   Chlamydia abortus S26/3: CAB752Help
Entry
CAB752            CDS       T00242                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cab  Chlamydia abortus S26/3
Pathway
cab00020  Citrate cycle (TCA cycle)
cab00640  Propanoate metabolism
cab01100  Metabolic pathways
cab01110  Biosynthesis of secondary metabolites
cab01120  Microbial metabolism in diverse environments
cab01130  Biosynthesis of antibiotics
cab01200  Carbon metabolism
Module
cab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAB752 (sucC)
   00640 Propanoate metabolism
    CAB752 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CAB752 (sucC)
Enzymes [BR:cab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CAB752 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAH64199
UniProt: Q5L593
Position
complement(870260..871420)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLTSYAIPMPPYRVASSVEEGRHTLNELGINAGVVKVQVHAGGRGKNGGV
IVAKSPEEILAAVDQLLHMRFVSNQTSGEALPVEKVLITPLVNIAAEYYLAVIMDRKNRC
PTIMLSKAGGVDIEEVAQKYPDQQLTISLTPFARLYNYQLRQMIKFMGWEGDTGKQGVQM
IKNLVQCFYDNDASLLEINPLVRTQEGDLLVLDAKVTIDDNALYRHPKLEVLYDPSQENV
RDVLAKQIGLSYIALDGNIGCLVNGAGLAMSTLDILKIHGGSAANFLDVGGSATEQQIQE
AVSLVLSDENVEVLFINIFGGIMDCSAVASGLVAVMQTRENLIPTVVRLEGTNVELGKEI
VQCSGIPCKFTDSLNTGAQLAVALSK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaataccaagctaaagacctcttaacctcttatgctatccctatgcct
ccttatcgtgtagcctcgtctgttgaagaaggtaggcatacgctcaatgagttaggaatc
aacgcaggtgtggttaaagtacaagtacatgctggaggtagggggaaaaacggtggggta
attgttgctaaatctcctgaggagattcttgcagctgttgatcaattgttacacatgcgt
tttgtcagcaatcaaacttctggagaagctttaccggtagagaaagttctgatcaccccc
ttagtgaatattgctgccgaatattacctagcagtcatcatggataggaaaaatcgctgc
ccaacgattatgttatcgaaagccggaggtgtggatattgaagaggtagctcaaaaatat
cctgaccaacagcttactatatccctgactccttttgctcgtctatataattaccaactt
agacagatgattaaatttatgggttgggaaggagatactgggaaacaaggcgtccagatg
attaaaaatcttgtccaatgtttctatgacaatgatgcttctttactggaaattaatcct
ttagtacgtactcaagaaggagatcttcttgtgctagatgctaaagtaacgattgatgat
aatgccctataccgtcatccaaaacttgaagtgttgtacgacccctctcaagaaaatgtt
cgtgatgtacttgctaagcagataggactttcctacattgctctagatggcaatattggt
tgcttagtgaatggtgccggattagctatgagcacattagacattcttaagattcatgga
ggatccgcagcaaatttccttgatgttggcggaagtgctaccgaacaacaaattcaggaa
gccgtatctttagtcctatcagacgaaaatgtcgaggttctttttatcaacattttcggt
ggaattatggattgttctgcggttgcctcaggactcgttgctgtgatgcaaactagagaa
aatctcattcctacagtagtacgtctagaaggaacaaatgtagaacttggcaaagaaatt
gtacagtgttcaggaatcccctgtaagtttaccgattccttaaatacaggcgcacagctt
gctgtagcattaagtaaataa

DBGET integrated database retrieval system