KEGG   Chlamydophila abortus: CAB805Help
Entry
CAB805            CDS       T00242                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cab  Chlamydophila abortus
Brite
Enzymes [BR:cab01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CAB805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(933569..934615)
Genome map
AA seq 348 aa AA seqDB search
MILLQIVKKYSLKQLKVLTTFLLGASSVSLHGVVQESSSKISWHLDYNEAVKKSRDSALP
MLIFFSGSDWNALCMKIRKEVLDSTEFAQKINGNFICLAVDFPRHSSQSEALHAQNTYLK
TKFKIDEFPSLLLLSHDGREIYKIGSFGNETGENLGESLCHIVESDCLLNNVYPVMHTLS
MEELQKYYRLSEEISCKDFIAKALELGVRNDDYFFLSEKYRLLVESGKMDSEECQKVKRK
LLDQDPKNEKHTHFTVALIEFQELAKRSQEGVSQDPSQVIAPLEAYLTEFGHQDQENVWR
IEMMIAQFYLDSDQWKSALQHAEVAFETAPKEVRSHIAHSLDYIRHQS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgttacagattgtgaagaaatattctttgaagcaactgaaggtattaacaacg
tttctattaggtgcaagttctgtaagtttgcatggcgttgttcaagagagttcttctaag
atttcttggcatctagattataacgaagctgtgaaaaaaagccgcgattccgcattgccc
atgttaatctttttttccggttccgattggaatgccttatgcatgaagattcgtaaagag
gttctggattctacggaatttgctcaaaagataaacgggaatttcatctgcttggcagta
gattttcctaggcattcttctcaaagtgaagccctacatgcacaaaatacatatctaaaa
actaagttcaaaattgatgagtttccttctcttcttttactctctcatgatggaagagaa
atttataaaatcgggtcttttggtaatgaaactggagaaaatctaggtgaaagcttatgc
catattgttgaaagtgactgtctactcaacaatgtctatccagttatgcacacattgtct
atggaagaactacagaagtattaccgactttctgaagagatctcatgcaaggatttcata
gccaaggctttagaattgggagtacgcaatgatgattacttcttcctatcagaaaaatat
cgtcttcttgttgaaagcggtaaaatggattctgaagagtgtcaaaaagtaaagcgtaaa
ttactcgatcaagatcctaaaaatgaaaaacatacacactttactgtcgctttaattgag
ttccaagaattggctaaaagatctcaagaaggagtgagtcaggaccctagtcaagtcatt
gcacctttagaagcttatttgacagagttcggacaccaggatcaggaaaatgtctggaga
atcgagatgatgatagctcagttttacctagactcggatcaatggaaaagtgctttacaa
cacgctgaagttgctttcgaaacagctcctaaggaagttcgctctcacattgctcattct
ttggactatattcgccaccaatcgtag

DBGET integrated database retrieval system