KEGG   Chlamydophila abortus: CAB808Help
Entry
CAB808            CDS       T00242                                 

Definition
hypothetical protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cab  Chlamydophila abortus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(938282..938797)
Genome map
AA seq 171 aa AA seqDB search
MSMKRWLQGSLIALCLLLTLPCCAAKRRSHYQKGIDKSTVHVVNTSGVQWESYNNAVEQS
KKDKKYIGLFFTGSDWCIWCMKMQDQILNTTEFQQYAHEHLHMVELNFPQSASQPEDLKQ
QNQALKAKYGVNGFPTLVFIDAHGVEKARMGFEYGGGESYVQKIKAALRTK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaacgttggttgcaaggaagtttaatagccctctgtttattacttacactg
ccttgttgtgcagcaaaaaggcgttctcattaccaaaaagggatcgataaatctactgta
cacgtggttaacacttctggagtacagtgggaaagttacaataatgctgtcgaacaatcc
aaaaaagataaaaaatatattggtttgttttttacaggctctgattggtgtatctggtgt
atgaagatgcaagatcagattttaaatactactgaatttcaacagtatgcgcatgagcac
ttacacatggtagagctgaatttcccacaatctgctagccaacctgaagatctaaaacaa
caaaatcaagctttaaaagcaaaatacggtgtaaatggattccccacattagtgttcatt
gatgctcatggagtcgagaaagctcgaatgggattcgagtacggcggtggtgagagttac
gttcaaaaaatcaaagctgctttgcgtacaaaatag

DBGET integrated database retrieval system