KEGG   Chlamydophila abortus: CAB814Help
Entry
CAB814            CDS       T00242                                 

Definition
sulfur metabolism-related protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cab  Chlamydophila abortus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CAB814
Enzymes [BR:cab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CAB814
Transfer RNA biogenesis [BR:cab03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CAB814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
945472..946452
Genome map
AA seq 326 aa AA seqDB search
MPSHLLDYQRVAESIVEKTIAELIRYRQRLPLVPFWTKPDGSFVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVDDKHKIHSILEFIHRLDAKATPDDLLETLSPNQKASTLYWLVD
PIDSTSGFIKNRFFASAVSLMYEDSPILAVMACPCADRHTFKIYSAAKNSGVSLFGTAIE
TRQYLKSGETLTGKFCEASLAARNQQHQATRLLSLSLPGQPQACRVDSQYKYAMVAEGAV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNALNYRREDFILENHPIILASGN
AEIHRTTLDALQEHLNIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatttactagactatcaaagagttgcagaaagtatagttgagaaaacaatc
gccgagttaatccgttatcgacaacgccttccgctagtccctttctggacaaaacccgac
gggtcttttgtgacacccgcagattatgctgttcaatattgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtagacgataaa
cataaaattcacagtattttagaattcattcacagactggatgcgaaagccacacctgat
gatcttttagaaacattaagtccaaatcaaaaagcctcaactttatattggctggttgat
cctattgatagtacgtcgggatttattaaaaaccgtttttttgcctctgccgtatccttg
atgtatgaggatagtcctatacttgcagttatggcatgtccgtgtgcagatcgccacacg
ttcaaaatctattcggctgctaaaaactctggggtttctttatttggcactgcaattgaa
actcggcagtatttaaaatctggagaaacactaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccaggctacacgcttattaagtctctctttaccggggcaa
ccccaagcttgtcgagttgacagtcaatacaaatacgctatggtcgctgaaggcgctgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggagcttttttagtagaagagtcgggaggtgtagtttctgatatttttgggaatgcgctc
aattaccgtcgtgaagatttcattttagaaaatcatcccataattctagcttccgggaat
gcggaaattcacaggactacgttagacgccttacaagaacacttaaatattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system