KEGG   Chlamydophila abortus: CAB872Help
Entry
CAB872            CDS       T00242                                 

Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cab  Chlamydophila abortus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAB872
   01230 Biosynthesis of amino acids
    CAB872
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAB872
  Energy metabolism
   00680 Methane metabolism
    CAB872
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAB872
Enzymes [BR:cab01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CAB872
Exosome [BR:cab04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CAB872
  Exosomal proteins of melanoma cells
   CAB872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1016074..1016757
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPEQKHMSKIYSDEVNHMIPLYRSSALNERMYGELQGKN
KKKTAEQFGEEQVKLWRRSYKTAPPNGESLYDTGQRTIPYFQETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVHSLELPTGKPIVYLWTGHTFERHPELFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacgggaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatattcccctaagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaagccatcaaagaccttcccatagattgcatctttacctcctctcttgtgcgaagttta
atgacggcattgcttgctatgacgcatcacaactctaaaaaaatcccttacattgttcac
gatgatcctgaacaaaagcacatgagtaagatctatagtgatgaagtcaaccacatgatc
ccactgtaccgttctagcgcactcaatgaaagaatgtacggggaactccaaggaaaaaat
aaaaaaaaaaccgctgagcaatttggggaggagcaagtaaaattgtggcgacgtagttat
aagaccgcccctcctaatggcgaaagtctttatgatactgggcaacgcaccatcccctat
tttcaggaaactattttccctttgttgcagaattcaaaaaatgtatttgtatctgcacat
ggaaattccttacgttcactcattatggatatagaaaaattaagtgaagaagaggtacac
tccttggagttacctacaggaaaacccatagtatatttatggaccggtcacacattcgaa
cgacatccagagttatttggttaa

DBGET integrated database retrieval system