KEGG   Clostridium acetobutylicum ATCC 824: CA_C0127Help
Entry
CA_C0127          CDS       T00056                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cac03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
138573..139169
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPGVGYKTAQRLTMHVLNLPKEEVEGFADALKKARGTIKYCSV
CGNYTDTDPCAICSNPNRDKSLVCVVEEPKDIISMEKVREFNGVYHVLHGVISPMLGKGP
DSIKLRELVSRMNGKVKEVIVATNPNVDGEATAMYISKILKPLGVKVTRIAHGIPVGGDL
EYADEVTLAKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattctatcctgtggcaattgagaaattaatagaagaatttgcaaaactgccaggt
gtcggatataaaacagcacaaaggcttacaatgcatgttttaaatctaccaaaggaagag
gttgaaggttttgcagatgcactaaaaaaggcaagaggaactataaaatactgttctgtt
tgtggtaattatacagatactgatccgtgtgcaatttgttctaatcctaacagagataag
agtcttgtttgtgttgttgaagagccaaaggatataatatctatggaaaaggtaagagaa
ttcaatggtgtttaccatgttcttcatggagtaatatctccaatgcttggaaaaggtcca
gattctataaaacttagagaacttgttagtaggatgaatggaaaagttaaggaagttatt
gttgcaaccaatcctaatgtagatggagaggctacagctatgtatatatcaaaaatctta
aaaccgcttggagttaaagttactagaatagctcatggtattccggttggaggagacctt
gagtatgcagatgaggtgactctagctaaagcgcttgaaggaagaagagaaatatag

DBGET integrated database retrieval system