KEGG   Clostridium acetobutylicum ATCC 824: CA_C0182Help
Entry
CA_C0182          CDS       T00056                                 

Definition
beta-glucosidase-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C0182
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CA_C0182
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CA_C0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206069..207631
Genome map
AA seq 520 aa AA seqDB search
MVMIDVKKLPLDIKIGQMIMAGFTSKHYDSSLEKLITDDKIGNFILFSRNIEEKNQLTRL
TEDIQKGLEINIKIPGIISVDQEGGMVTRINSGTTIFPGNMAFAAANHPHSTFRQGKIEG
EELRGLGVNMNLAPVMDVNCNPSNPVIGVRSYSDSPEKVAELGLELIKGLKESKVVPVAK
HFPGHGDTDVDSHLSLPVVKHSIKRLRKVELLPFKTAIENGIDAIMSAHVLFPEIEPKRL
PATLSYRVLTDLLRNKMGFKGIIITDCMEMKAIAEFYGSDKAAVMAIKAGADLICISHSA
AVQKACIRRIKEAVINKEISEERINESVKRILEIKEKYSISFNTVKRNYDINNSLFAEEI
SDKSITLLKNDKSLIPLKGRIVSISTKAVALTGAEDNMSLNNSFCHKLKENFGGSEFQIP
INPHKEIIDKILEKCLDADSIVIGIYNAYNHEGQRKLVNEISKVNPNIVLVSLRNPYDFL
YFKEVSAYINAYEYTNLSVKSVIKVLSGRVEAQGISPVRL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggttatgattgatgtaaaaaagcttcctcttgatataaaaataggacaaatgataatg
gcagggtttacttcaaagcattacgattcttctttggaaaaactgattacagatgataag
ataggaaatttcatattgttttcgagaaatatagaagagaaaaatcagctcacaaggctt
acagaggatattcaaaaaggactagaaatcaatattaaaattccaggaattatttctgtt
gatcaagaaggtggaatggttacaagaataaattcagggactacaatatttcctggaaat
atggcttttgcagcagcaaatcatccacatagcacttttagacagggaaaaattgaggga
gaagagcttagaggtttgggtgtaaatatgaatctagcaccagttatggatgtgaactgt
aatcccagtaacccagttataggagttaggtcttatagtgatagtcctgaaaaagtagca
gaactgggtttggaattaataaaaggtttaaaagaaagtaaggtagttccagttgcaaag
catttcccgggacatggagatacggatgtggattctcaccttagtttgcctgtagtaaag
cattctattaaaaggcttcgtaaagtcgagcttcttccatttaagactgcaatagaaaat
ggaattgatgcaataatgtcagcacatgtgctctttccagaaatagaacccaaaaggctt
cctgctacactttcatatagggttcttacagatttattaagaaataaaatgggttttaag
ggcattataataacagattgcatggagatgaaggctatagcagagttctatggcagtgat
aaggcagcagttatggcaattaaagcaggagcagatttaatttgtatatcccatagtgcg
gcggtacagaaagcttgtatacgtagaattaaagaagcagtaataaataaagaaatctct
gaagagagaataaatgaatcagtaaaaagaattctagaaataaaagagaaatatagcatt
tcatttaatacagtcaaaagaaactatgatataaataatagtcttttcgcagaagaaata
agtgataaaagcataacacttctaaagaacgataaaagtttaatcccacttaaaggaagg
attgtatccatatctacaaaagcagtagcacttactggggctgaagataatatgagccta
aacaattctttttgtcataaattaaaagagaactttggtggcagtgaatttcaaatacca
attaatccccataaagaaataatagataaaatattagaaaaatgcctagatgcagatagt
atagtaataggtatttataatgcatacaatcatgaaggtcaaagaaaacttgtgaatgaa
ataagtaaggttaatcctaatatagtactggtatccttaaggaatccctatgatttttta
tattttaaggaagtttcagcttatataaatgcctatgaatacactaatttgtcagtaaaa
agtgtaattaaagtattatcgggaagagtagaggctcaagggatttcaccagttagactt
tag

DBGET integrated database retrieval system