KEGG   Clostridium acetobutylicum ATCC 824: CA_C0214Help
Entry
CA_C0214          CDS       T00056                                 

Definition
(RefSeq) aminopeptidase
Organism
cac  Clostridium acetobutylicum ATCC 824
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
238706..239746
Genome map
AA seq 346 aa AA seqDB search
MDTKLLLRELCLKDAPSGAEKELYDVVNREFSEFGNVEIDELNNIYINKRGKGAGKIALM
AHGDEIFLMISGFEKNGFLKFKAVGIDPKVLISQEVKIHGKREVLGIIGVKPPHLMNDKE
KEAAIPTSELLIDTGFSTDKLKEIVNIGDYVTIKRDFYELLNNNVACKAMDNRASITAMY
VCARELNKIDHNADVVFICSCQEEVGHRGAKMSAYKTKPDICIAVDVTFDGGKLGDPDRE
NEVGGGPVICIGPNIHAKVRKKVIGIANKYNIPYKVEVEPGNTGCDAWDTQISRDGIPSL
LISVPEKYMHTSVEMVNIEDIENTGKLIAKFIEELNNIEMEELLCF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttggacactaaattattattaagagaattatgtttgaaggatgcaccaagtggagctgaa
aaagaactttatgacgttgtaaatcgagaattttcggaatttggaaatgtagaaatcgat
gaactaaataatatatacataaataaacgtggaaagggagctggcaaaattgcacttatg
gctcacggagatgagatttttcttatgataagtggttttgaaaaaaatggcttcttaaaa
tttaaagcagtaggaatagatcctaaagtattgatttctcaggaagttaaaattcacgga
aaaagagaagtacttggaattataggtgtaaagccaccgcatttaatgaatgataaggaa
aaggaagctgcaattcccacaagtgagcttttaatagatacaggttttagtactgataag
ttaaaggaaatcgtaaacataggagattatgtaacgattaaaagggatttttatgaactt
ttaaataataatgtggcttgtaaggcaatggataatagagctagcataacagcaatgtat
gtgtgtgcaagagaattgaataaaatagatcacaatgctgatgtggttttcatatgctca
tgccaagaagaggttggacacagaggagctaaaatgtcagcgtataagactaagcctgat
atatgtatagcagtggatgttacctttgacggaggaaaacttggagatccagatagagaa
aatgaagtaggaggaggtccggttatatgtataggtcctaatatacacgcaaaggttaga
aaaaaagtaattgggattgcaaacaagtataatattccttataaagttgaagttgaacct
ggaaacacaggttgtgatgcatgggacactcagatatctagagatgggattccatcgctt
ttaatatctgtgcctgaaaaatatatgcatacctctgttgagatggttaatatagaagac
atagaaaatacaggtaagcttatagctaaatttattgaagagctaaataacattgaaatg
gaggaacttttatgcttttag

DBGET integrated database retrieval system