KEGG   Clostridium acetobutylicum ATCC 824: CA_C0517Help
Entry
CA_C0517          CDS       T00056                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA_C0517 (pfkA)
   01230 Biosynthesis of amino acids
    CA_C0517 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C0517 (pfkA)
   00030 Pentose phosphate pathway
    CA_C0517 (pfkA)
   00051 Fructose and mannose metabolism
    CA_C0517 (pfkA)
   00052 Galactose metabolism
    CA_C0517 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CA_C0517 (pfkA)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CA_C0517 (pfkA)
Protein phosphatases and associated proteins [BR:cac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CA_C0517 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
596226..597185
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDI
IQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTV
GLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFS
GIAGGAESVIIPEIGYDFNELCKNILEGKLRGKMHNLIILAEGVGGAAELAKKVEEVTGI
ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGKTSRVIGIKEGKIMDQDIDEAL
AVPRSFNKELYDIANMLSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgttttaacgagtggtggagatgcaccaggtatgaatgctgctata
agagcggtagtaagaactgccattgaaaagggtattaatgttaagggcatacaaagaggg
tacagtggccttataaatggcgaaatatttgatatgaatagacacagcgtatcagatata
atacaacgaggaggcactattttaagaacagcacgttgtccagaatttcttaaagaagaa
gttagacaaaaggcagcaaatgttttaagggtttttggtatagatggtctcgttgtaata
ggtggaaatggttcttttatgggagcacaaaagctttctaagcttggagtaaagacggtt
ggacttccgggaacaatcgataatgatcttccatatacagattacaccataggttttgat
actacacttaatactgtattagacgcaattaataaacttagagatacttctacttctcat
gaaagagtaagtataatcgaggttatgggaagagattgcggtgatatagctctgttttct
ggaatagctggaggagcagaaagtgtaataatacctgaaattggttatgattttaatgag
ctttgtaaaaacatcttagaaggaaaattaagaggaaaaatgcataatcttataatactt
gcagaaggtgttggaggagcagctgagcttgcaaaaaaagttgaagaagttactggtata
gaaaccagatccacaatacttggtcatattcaaagaggaggaagtccatcagcctttgat
agaatgcttgcatctagaatgggagtaaaggctgtagaagtcttaatggaaggaaaaacc
tctagagttataggtattaaagaaggaaaaataatggatcaagatattgatgaggcttta
gcagttccaagaagttttaataaagagttatatgatatagcaaatatgctttcaaaatag

DBGET integrated database retrieval system