KEGG   Clostridium acetobutylicum ATCC 824: CA_C0517Help
Entry
CA_C0517          CDS       T00056                                 

Gene name
pfkA
Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00010  Glycolysis / Gluconeogenesis
cac00030  Pentose phosphate pathway
cac00051  Fructose and mannose metabolism
cac00052  Galactose metabolism
cac00680  Methane metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01130  Biosynthesis of antibiotics
cac01200  Carbon metabolism
cac01230  Biosynthesis of amino acids
cac03018  RNA degradation
Module
cac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cac_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C0517 (pfkA)
   00030 Pentose phosphate pathway
    CA_C0517 (pfkA)
   00051 Fructose and mannose metabolism
    CA_C0517 (pfkA)
   00052 Galactose metabolism
    CA_C0517 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CA_C0517 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CA_C0517 (pfkA)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CA_C0517 (pfkA)
Protein phosphatases and associated proteins [BR:cac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CA_C0517 (pfkA)
Messenger RNA biogenesis [BR:cac03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CA_C0517 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 1116700
NCBI-ProteinID: NP_347157
UniProt: O08308
Position
596226..597185
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTAIEKGINVKGIQRGYSGLINGEIFDMNRHSVSDI
IQRGGTILRTARCPEFLKEEVRQKAANVLRVFGIDGLVVIGGNGSFMGAQKLSKLGVKTV
GLPGTIDNDLPYTDYTIGFDTTLNTVLDAINKLRDTSTSHERVSIIEVMGRDCGDIALFS
GIAGGAESVIIPEIGYDFNELCKNILEGKLRGKMHNLIILAEGVGGAAELAKKVEEVTGI
ETRSTILGHIQRGGSPSAFDRMLASRMGVKAVEVLMEGKTSRVIGIKEGKIMDQDIDEAL
AVPRSFNKELYDIANMLSK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgttttaacgagtggtggagatgcaccaggtatgaatgctgctata
agagcggtagtaagaactgccattgaaaagggtattaatgttaagggcatacaaagaggg
tacagtggccttataaatggcgaaatatttgatatgaatagacacagcgtatcagatata
atacaacgaggaggcactattttaagaacagcacgttgtccagaatttcttaaagaagaa
gttagacaaaaggcagcaaatgttttaagggtttttggtatagatggtctcgttgtaata
ggtggaaatggttcttttatgggagcacaaaagctttctaagcttggagtaaagacggtt
ggacttccgggaacaatcgataatgatcttccatatacagattacaccataggttttgat
actacacttaatactgtattagacgcaattaataaacttagagatacttctacttctcat
gaaagagtaagtataatcgaggttatgggaagagattgcggtgatatagctctgttttct
ggaatagctggaggagcagaaagtgtaataatacctgaaattggttatgattttaatgag
ctttgtaaaaacatcttagaaggaaaattaagaggaaaaatgcataatcttataatactt
gcagaaggtgttggaggagcagctgagcttgcaaaaaaagttgaagaagttactggtata
gaaaccagatccacaatacttggtcatattcaaagaggaggaagtccatcagcctttgat
agaatgcttgcatctagaatgggagtaaaggctgtagaagtcttaatggaaggaaaaacc
tctagagttataggtattaaagaaggaaaaataatggatcaagatattgatgaggcttta
gcagttccaagaagttttaataaagagttatatgatatagcaaatatgctttcaaaatag

DBGET integrated database retrieval system