KEGG   Clostridium acetobutylicum ATCC 824: CA_C0554Help
Entry
CA_C0554          CDS       T00056                                 

Gene name
lyc
Definition
1,4-beta-N-acetylmuramidase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cac  Clostridium acetobutylicum ATCC 824
Brite
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CA_C0554 (lyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
641317..642291
Genome map
AA seq 324 aa AA seqDB search
MKGIDIYSGQGSVDFNAVKESGVEVVYIKATEGLTYTDSTYKDFYDGAKNAGLKIGFYHY
LRANDPTSEAEHFFNTISGLSLDCKCAIDVEVTLGQSIDQISSNVRKFADYLINKGLDVC
VYTYTNFYKDNLNSTVKDLPLWIAEYGVSKPNIDASYVGFQYSDSGSVNGISGSADLDEF
SEGILVGGTVVIDPGQGGDDNIKAIQQDLNILLKRGLEVDGIEGPETEAAIKDFQSIMGL
TVDGIWGTNTSGAAQQIFSRPLDGVAYPHYEYATRYIQYRVGASVDGTFGSGTKAKVAAW
QSNQGLMADGVVGSATWSKLLDEN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatcgatatttattcaggacaaggaagcgtagattttaatgcagttaaagaa
agtggggtagaagttgtttatataaaagcaacagagggattaacatatacggattcaact
tacaaggatttttatgatggagcaaaaaatgcaggacttaaaattggtttttatcattat
ttaagagcaaatgacccaacaagtgaggcagaacatttttttaatacaatttcaggactt
tcattagattgtaaatgtgctatagatgttgaagtaacattaggtcaaagtatcgaccaa
ataagttcaaatgttagaaaatttgcggattatttgataaataaaggattggatgtttgt
gtatatacctatactaacttctataaagataatttaaatagtacggttaaagatttgcct
ttatggatagctgaatatggcgtaagtaagcctaatatagatgcttcatatgttggattt
caatattcagatagcggttctgtgaatggtataagtggttctgctgatttagatgaattt
tcagaggggatacttgttggaggtacagttgttatagatccaggacagggtggagatgat
aatataaaggctattcaacaggatcttaatatcttactaaaaagagggctagaagttgat
ggaatagaaggaccagagactgaggctgctataaaagattttcaatccattatgggactt
acagtagatggaatttggggaacaaatacttcaggggctgcacagcaaattttttcaaga
cctctagatggagttgcatatcctcattatgaatatgcaacaagatatattcaatataga
gttggagcaagtgtagatggtacctttggtagcggaacaaaagcaaaagttgcagcttgg
cagtcaaatcagggacttatggctgatggtgttgttggatcggctacttggtcaaagcta
ttagatgaaaattaa

DBGET integrated database retrieval system