KEGG   Clostridium acetobutylicum ATCC 824: CA_C0706Help
Entry
CA_C0706          CDS       T00056                                 

Definition
endo-1,4-beta glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CA_C0706
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CA_C0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
816062..818230
Genome map
AA seq 722 aa AA seqDB search
MKRNRMKILNLPIFFVVLMFLLSNVGIIRVKANNLTPVEINGQLKVSGSKLLNSNNQPIQ
LKGMSSFGIQYSPQFVNYNTMKYLRDNWGMNVFRVAMYTDGDGGYIFNKAACKAKVEEAV
NAAQKLGIYVIVDWHMFNNPQTDKSQSKDFFNQISSEYKNSPNVIYEIANEPCGDVTWGR
DIKPYANEVIPVIRANSPNAIVIVGSPTWSQSVLDPANDPLSFSNVMYACHFYAGTHGQW
LRDRITQALNKNIALFATEWGTSDCNGSGGTYIEESQRWVDFMTQNKISWTNWVLDDANA
TASILKPGSNPNGGWTDNDLTESGKFVKAAMLQNNTPTTGGNTTPTTGGNTTPTTGGNTT
PTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGGNTTPTTGAVIDTSKT
YKIISSSTGKVLNVRNYSSQSGAQIEELVDVGALSEQWKIADSGNGSYKITSALSNLSLD
GGVSTEGTDVKQYQYAGAENQQWNIEKINANTYKITNKKSNLALETTGVYDSADIQLWNY
TGKGTQQWIISDVNAGTNTTPTTGGNTTPTTGGNTTPTTGSAIDNSKTYKIISQNTGKVL
NVRNYSSESGAQIEELVDVGALSEEWKITNSGNGSYKITSALSNFSLDAGTSTEGSDVKQ
YQYTGAESQQWNIEKIAANTYKITNKKSGLALNGTGAWDGSNLQLAKYSSTADQQWILKA
VN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaatagaatgaaaattttaaatttaccaatattttttgtagtactaatgttt
ttactatcaaatgttggtattattagggtcaaagcaaacaatttaacaccagttgaaata
aatggtcaacttaaggtttcaggaagtaaattactaaattcaaacaatcaacctattcaa
ctcaaaggtatgagtagttttggtatacaatactcgccacagtttgtaaattataatact
atgaaatatttaagagacaactggggaatgaatgtatttagagttgctatgtatactgac
ggagatggaggatatatatttaataaggcagcttgtaaagcaaaggttgaagaggctgta
aatgctgctcaaaagttaggtatatatgtaattgttgattggcatatgtttaataatcct
caaactgataaaagtcagtcaaaggacttctttaatcaaatttcaagcgaatataaaaat
tcacctaatgtaatctatgaaatagcaaatgaaccatgtggcgatgtaacttggggaaga
gatataaaaccatatgcaaatgaggttataccagttattagagccaattcgcctaatgca
atagttatagttggtagtcctacatggagtcaatctgttctagatcctgccaatgatcct
ttaagcttcagtaatgtaatgtatgcgtgccatttttatgctggaacacatggtcaatgg
cttagagatagaataacacaagctcttaacaaaaacatagctttatttgctacagaatgg
ggaactagtgattgcaatggtagtggaggaacttacatagaagaatctcaaagatgggta
gattttatgacccaaaataaaataagttggactaattgggttttagatgatgcaaatgca
acagcatcaatattaaagcctggaagtaatcctaatggaggatggactgacaatgatttg
acagagtcaggaaagtttgtaaaggcggctatgcttcaaaataatacaccaactacaggt
ggaaacacaacaccaactacaggcggaaacacaacaccaactacaggtggaaacacaaca
ccaactacaggtggaaacacaacaccaactacaggtggaaacacaacgccaactacaggt
ggaaatacaacgccaactacaggtggaaatacaacaccaactacaggtggaaatacaacg
ccaactacaggtggaaatacaacgccaactacaggagctgtaatagatactagtaaaaca
tataaaataatatcttcaagtacaggtaaggttttaaatgtaagaaactatagttctcaa
agcggagcacaaatagaagaattagttgatgttggtgcgttatcagaacagtggaaaata
gcggattcaggcaatggaagctataaaattacttctgcattgagtaatttaagcttagat
ggtggtgtaagtactgaaggaactgatgttaaacaatatcaatatgcaggtgcagaaaat
cagcagtggaatattgaaaaaataaatgccaatacttataaaatcacaaataagaaaagt
aatttagcattagaaactactggagtttatgatagtgcagatattcaactttggaattac
acaggaaaaggaactcaacagtggataatttcagatgtgaatgcaggaacaaatacaaca
ccaactacaggcggaaatacaacaccaactacgggtggaaatacaacaccgactacagga
agtgctatagataatagtaaaacatataaaataatatctcaaaatacaggtaaagtttta
aatgtaagaaattatagttctgaaagtggagcacaaatagaagagttagttgatgttggc
gcactatccgaagaatggaaaataacaaattcaggtaatggaagctataaaattacgtct
gctttaagtaattttagtttggatgcaggtacaagtactgagggttctgatgttaaacag
tatcagtatactggcgcagaaagtcaacagtggaatattgaaaaaattgctgctaatact
tataaaataacaaataagaaaagcggtttagctttaaatggaactggagcttgggatggt
tctaaccttcaattagctaaatatagcagtacagcagatcagcagtggatacttaaggct
gttaactaa

DBGET integrated database retrieval system