KEGG   Clostridium acetobutylicum ATCC 824: CA_C0711Help
Entry
CA_C0711          CDS       T00056                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00010  Glycolysis / Gluconeogenesis
cac00051  Fructose and mannose metabolism
cac00562  Inositol phosphate metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01130  Biosynthesis of antibiotics
cac01200  Carbon metabolism
cac01230  Biosynthesis of amino acids
Module
cac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cac_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C0711 (tpiA)
   00051 Fructose and mannose metabolism
    CA_C0711 (tpiA)
   00562 Inositol phosphate metabolism
    CA_C0711 (tpiA)
Enzymes [BR:cac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CA_C0711 (tpiA)
Exosome [BR:cac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CA_C0711 (tpiA)
  Exosomal proteins of bladder cancer cells
   CA_C0711 (tpiA)
  Exosomal proteins of melanoma cells
   CA_C0711 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1116894
NCBI-ProteinID: NP_347348
UniProt: O52633
Position
823748..824494
Genome map
AA seq 248 aa AA seqDB search
MRTPIIAGNWKMNNTISESLKLIEELKPLVKDAKAEVVVAPTAVSLETVVNATKGSNIKV
AAQNAHFEESGAFTGEISLKALEELGVSYVILGHSERRQYFNETDCALNKKVKAAFAHNI
TPILCCGETLEEREANVTNEVTGKQIKLDLAGLSAEQAAKVVIAYEPIWAIGTGKTATDE
QANETIGAIRKTVEVMFGKEVAEKVRIQYGGSVKPNTIKAQMAKPEIDGALVGGASLKAA
DFAAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaataatcgccggtaattggaaaatgaataacacaattagtgaatcttta
aaattaattgaagaattaaagccacttgtaaaagatgcaaaggctgaagttgtagtagca
cctacagctgtttctttagaaactgttgttaatgctacaaaaggaagtaacattaaggtt
gctgcacaaaatgcacactttgaagaaagtggagctttcactggagaaatatcactaaaa
gcacttgaagaattaggtgtaagttatgtaatattaggtcatagtgaaagaagacagtat
tttaatgaaacagattgtgctttgaataaaaaagtaaaagcagcatttgctcataatata
actccaatattatgctgcggagaaactcttgaagaaagagaagcaaatgtaacaaatgaa
gttacaggaaagcaaataaagttagatttagcaggattaagtgctgaacaggcagctaag
gttgttatagcttatgaaccaatttgggcaataggaacaggtaaaactgctacagatgaa
caggcaaatgaaacaattggagcaatcagaaaaacagtagaagtaatgttcggaaaagaa
gttgcagaaaaagtaagaatacaatatggtggttctgtcaaaccaaatacaattaaagct
caaatggctaagccagaaatagatggagcattagttggaggagcaagccttaaagcagct
gattttgcagcaatagttaatttctaa

DBGET integrated database retrieval system