KEGG   Clostridium acetobutylicum ATCC 824: CA_C0937Help
Entry
CA_C0937          CDS       T00056                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00340  Histidine metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01230  Biosynthesis of amino acids
Module
cac_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    CA_C0937 (hisD)
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CA_C0937 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1117120
NCBI-ProteinID: NP_347573
UniProt: Q97KI2
Position
1078266..1079561
Genome map
AA seq 431 aa AA seqDB search
MEDIIRIIQDGSLDGEKYFQSLKERQGKENAEIIKTVKFIIDNVKENGDKALIEYTSKFD
KVELQSIEVTKEEIKAAYSKVENDFICALKTAKENIEEYHSKQVQNSYVITKENGIVMGR
TVRGLDKVGIYVPGGTAAYPSSVIMNAVPAKVAGVNKIIMTTPPMKDGFVNPSILVAADL
AGVDKIYKVGGAQAIAALAFGTETIDKVDKIVGPGNIFVAMAKKSVYGFVDIDMIAGPSE
ILVISDETGNPKFIAADLMSQAEHDTLASSILVTTSKELIGKVIEEIKLQVEGLSRKEII
LEALRNFGAIILVDSISRAIEIGNVVAPEHLEIITPNPFEYLNDIKNAGSIFLGSYSPEP
LGDYMAGPNHVLPTSGTARFSSPLSVDDFVKKSSYLYYSEKALRNVNDKVVKIAETEGLT
AHANSIKVRFK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttggaagatattataagaataatacaagatggcagtttggatggggaaaagtactttcag
tcattaaaggagagacagggaaaagaaaatgctgagataattaaaacagtgaaattcata
atagataatgtaaaggaaaatggagataaagcacttattgaatacactagcaaatttgat
aaagtagagcttcaaagtatagaggttacaaaagaagaaataaaagctgcttacagtaaa
gtagagaatgactttatttgtgcccttaaaactgcaaaggaaaacattgaggagtatcac
tcaaaacaagttcaaaattcatatgttataactaaggaaaatggtattgtaatgggaaga
acagtaaggggacttgataaagttggtatatatgtaccaggaggaacagcggcatatcct
tcatcagttattatgaacgcagtacctgctaaggttgcaggagtaaataaaattataatg
actactccacctatgaaagacggctttgtaaatccgagcattctagttgcagcagattta
gctggagttgataagatatataaggtaggaggagctcaagcaattgcagcgcttgcattt
ggaactgagacaatagataaagtagataagattgtaggacctggaaatatatttgttgca
atggcaaagaaaagtgtatatggatttgtagatatagatatgatagcaggtccaagtgag
atacttgttatttcagatgaaacaggaaatcctaaatttatagctgcagatttaatgtca
caagcagaacacgacacacttgcctcatctattttagttacaacttcaaaagaacttata
ggtaaggttatagaagagataaaacttcaagtagagggattaagtagaaaggaaataata
cttgaagctttaaggaattttggtgccataatattggtagatagtataagtagagccata
gaaataggaaatgttgtagctccagaacatcttgaaatcataacgcctaatccctttgaa
tatttgaatgatataaaaaatgcaggctcaatatttttaggaagctattctccagaaccc
ttaggggattatatggcaggacctaatcatgtgcttcctacaagtggaacagctagattc
tcttctccactttcggtagatgattttgttaagaagtcaagttatttatattattcagaa
aaggctcttagaaatgtgaatgataaggtagttaagattgctgaaacagaaggacttaca
gcacacgctaattcaattaaagtaagatttaaataa

DBGET integrated database retrieval system