KEGG   Clostridium acetobutylicum ATCC 824: CA_C1084Help
Entry
CA_C1084          CDS       T00056                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cac00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1250866..1252290
Genome map
AA seq 474 aa AA seqDB search
MLSEFPKNFLWGASSAAYQVEGAWKEDGKGESVWDNFSKIPGKTFEGTNGDVAVDHYHRF
KEDVALMAEMGLKAYRFSVSWSRIYPKGRGKVNLKGLEFYKNLVDELLKYNIEPVLTLYH
WDLPQALQDLYGGFESRNVISDFENYCITLFKNFKDKVKYWITFNEQNVFTNLGYRCAVH
PPGIKDIKKYYLANHIVNLANASAIKAFRKYVPNGKIGPSFGMGPVYSFDCKPENVLAGD
EAEEYFNHWWLDVYCFGKYPTITLNRLEKLKVMPEITKEDLQLLREAKPDFIGLNYYHGG
TVMANDNVIRENLDKKDPYLVENSEEDKGFKYISNPFLKKTEWNWEIDPQGLRIALRRLT
NRYNLPILITENGIGAVDRLEEDERINDDYRIEYLKAHVLACKEAIDDGVQLIGYLPWSF
TDLLSWLNGYKKRYGFVYINRDEHSQKDLRRIKKKSFYWYKDVIEKNSDNIYGR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtgaatttccaaagaattttttgtggggagcatcttcagcagcctaccaggtt
gaaggggcttggaaagaagatggaaaaggagaatctgtatgggataacttttctaagatt
cctggaaaaacttttgagggcacaaatggagatgttgcagtagatcattatcataggttt
aaggaagatgttgcgttaatggcagaaatggggcttaaggcctatagattttctgtgtct
tggtcaagaatatatcctaaaggaagaggaaaagtaaatttaaagggtttagaattttat
aaaaatttagtagatgaattacttaagtataatattgaaccagttcttacgttatatcat
tgggatttaccacaggcgcttcaggatttatacggaggttttgaatcaagaaatgtaata
tctgattttgaaaactactgtataaccttatttaagaactttaaggataaggttaaatac
tggataacctttaatgaacaaaatgtatttacaaacctagggtacagatgtgctgttcat
ccaccaggtattaaagatataaaaaaatactatttagcaaatcatattgttaatttggcc
aatgcttcagcaataaaagcatttagaaaatatgttccaaatggaaagataggaccaagt
tttggaatgggaccagtgtattcttttgattgtaagcctgaaaatgtcttagcaggggat
gaggcagaggagtattttaatcattggtggcttgacgtatattgtttcggaaaatatcca
acaattactttaaatcgtttagaaaagttaaaggttatgccagaaataaccaaagaggac
ttacagcttttaagagaagctaagcctgattttataggactaaattattatcatggtgga
actgttatggcaaatgacaatgtaattagagaaaacttagataaaaaagatccttattta
gttgaaaacagtgaagaagataagggatttaagtatatttctaacccatttcttaagaaa
acggaatggaattgggaaatagatccacaaggcttaagaatagctttgagaagattaact
aatagatataatttaccaattttaataacggaaaatggtattggagcggttgatagactt
gaagaagatgaaagaataaatgatgattatagaatagagtacttaaaagcacatgtgtta
gcctgcaaagaggctattgatgatggagtacagttaattggttatttaccttggtcattt
actgatttgttaagttggcttaatggttataaaaaaaggtatggctttgtttatataaat
agagatgaacattcacaaaaggatttaagaagaattaaaaagaaaagcttttattggtac
aaggacgtaatagagaaaaatagtgacaatatttatgggaggtaa

DBGET integrated database retrieval system