KEGG   Clostridium acetobutylicum ATCC 824: CA_C1321Help
Entry
CA_C1321          CDS       T00056                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cac00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1461423..1462919
Genome map
AA seq 498 aa AA seqDB search
MKKYIIALDQGTTSSRAIIFDHEQNILEISQKEFTQIYPSKGWVEHNPLEIWSSQYGVLQ
EVMAKANITQENIAAIGITNQRETTIVWDKNTGEPVYNAIVWQCRRTADIVEGLKRDKEF
SDYVKENTGLILDAYFSATKIKWILDNVEGAREKAEKGELLFGTVDTWLVWKLTNGKVHV
TDYTNASRTMLYNIKELKWDERILRKLNIPRSMLPEVKNSSEVYGYTNLGGKGGIRVPIA
GMAGDQQCALFGQTCFEEGSVKNTYGTGCFLLMNTGENIIQSKNGLVTTIAIGLEGKVQY
ALEGSVFVGGAVIQWIRDELKLVSDAADTEYFAKKVNDNGGVYVVPAFTGLGAPYWDMYA
RGAIFGLTRGANKNHIIRAALEAIAYQSRDLIDAMKEDSGCEITRIKVDGGASRNNLLMQ
FQADITGTEVVRPIITETTALGAAYLAGLAVGFWKSKEEIAEKWSVSEVYTPNLDEDEKI
RLYNGWKRAVERVQGWEE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatataatagcattagatcaaggaactacaagttcaagagcaataatattt
gaccatgaacaaaatatattagaaattagtcaaaaggaatttactcaaatctatccgagt
aaaggatgggttgagcataatcctttagagatatggtcaagtcaatatggagttttgcaa
gaagtaatggcaaaagctaatataactcaagaaaatattgcagcaataggaattactaat
caaagagaaacaacaattgtttgggacaaaaatactggagaacctgtgtataatgctatt
gtatggcagtgtagaagaacagcagatatagtggaaggacttaagagagataaagagttt
tcagattatgtaaaagaaaatacaggattaatattagatgcatatttttcagcaacaaaa
ataaagtggatattagataatgtagagggtgcaagagaaaaagctgaaaaaggtgaattg
ctatttggtacagttgatacttggcttgtatggaagctaacaaatggcaaagtccatgta
accgattacacaaatgcatctagaactatgctttataatataaaggaattaaaatgggat
gaaagaattttaagaaaacttaatattccaagatcaatgctaccagaagttaaaaattca
tccgaagtttatggatatacaaaccttggaggtaaaggtggtattagagtaccaatagca
ggcatggcaggagatcaacaatgtgcattatttggtcaaacctgttttgaagaaggtagt
gttaaaaatacttatggcacaggatgctttttacttatgaatacaggagaaaatataatt
cagagtaaaaatggactagtaacgacaattgcaattggattagaagggaaagttcaatat
gcattagaaggttcagtgtttgttgggggggcagttattcagtggattagagatgaactt
aagttagttagcgatgctgcggatacagagtattttgctaaaaaagtgaatgacaatggt
ggagtatatgtggtaccagcatttactggtcttggagctccatattgggatatgtatgct
agaggagcaatttttggtctgacaagaggcgcaaataaaaaccatataattagagcggca
cttgaagctattgcatatcagtcaagagatcttatagatgcaatgaaagaagattcggga
tgtgaaattacaagaattaaagttgatggaggagctagtagaaataatttattaatgcag
tttcaagcagacattacaggaacagaagttgtaagacctataataactgaaacaacagca
cttggtgcagcttatttagccggacttgctgtaggcttttggaagtcaaaagaagaaatt
gccgagaagtggtctgtgagtgaggtgtatactccgaatttagatgaggatgagaaaata
agattatataacggttggaagagagcagttgaaagagttcagggctgggaagaataa

DBGET integrated database retrieval system