KEGG   Clostridium acetobutylicum ATCC 824: CA_C1571Help
Entry
CA_C1571          CDS       T00056                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CA_C1571
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CA_C1571
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CA_C1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1715302..1715847
Genome map
AA seq 181 aa AA seqDB search
MSIYDFKVKDINGEDISMEEYRGKALLIVNTASKCGFTPQYEDLEALYKKFKGENFEVLG
FPCNQFENQEPGTNNDIKKFCQINYGVTFKIFDKVDVNGENEAPLYRYLKEQAPFKELDE
STPTAKIIAAFLREKLPETLIGDSIKWNFTKFLIDKNGRVVNRFESGVEPMEIESYIKAL
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatatgattttaaggttaaggatataaatggagaagatataagcatggaagag
tataggggaaaggctcttctaatagtaaacacagctagtaaatgtggatttacacctcaa
tatgaggatttggaagccttatataaaaaattcaagggtgaaaattttgaggttttagga
tttccgtgtaaccaatttgaaaatcaggagcctggaactaataatgatataaagaagttt
tgtcaaataaactacggagttacctttaaaatattcgataaggtagatgtaaacggagaa
aatgaagctccattatataggtatctaaaggaacaagctccatttaaggaacttgatgaa
agtacacctacagctaagataatagctgcatttttaagagaaaagcttcctgaaacactt
attggcgattctataaagtggaattttacaaagtttttaattgataaaaatggtagagta
gttaatagatttgaatctggggtagaaccaatggagatagaaagttatattaaggctctt
atataa

DBGET integrated database retrieval system