KEGG   Clostridium acetobutylicum ATCC 824: CA_C1572Help
Entry
CA_C1572          CDS       T00056                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA_C1572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C1572
   00030 Pentose phosphate pathway
    CA_C1572
   00051 Fructose and mannose metabolism
    CA_C1572
  Energy metabolism
   00680 Methane metabolism
    CA_C1572
Enzymes [BR:cac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CA_C1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1716058..1718055
Genome map
AA seq 665 aa AA seqDB search
MLLESNTKNEEIKDNLKYLVLLSKQYPTINEAATEIINLQAILNLPKGTEHFLSDVHGEY
EQFIHVLKNASGVIKRKIDDIFGNRLMQSEKKSLATLIYYPEQKLDIILKQEKNIDDWYK
ITLYRLIEVCRNVSSKYTRSKVRKALPKEFSYIIEELLHEQPKGVDKQEYYDEIIKTIIS
IDRAKEFITAISKLIQRLVVDRLHIIGDIFDRGPRADIIMDKLEEYHAVDIQWGNHDILW
MGAASGSSVCMANVIRISARYANLSTIEDGYGINLLPLATFAMDFYGNDKCKNFEPKIES
DKSYTVKEIELIGKMHKAIAIIQFKLEGEAIKRHPEFKMEHRMLLNKINFEDSTIELDGK
KYKLNDTSFPTIDKNDPYKLIDEEREVVEKLRSSFVNSEKLNRHVRFLFSHGNLYLKFNS
NLLYHGCIPLNEDGTFKEVLIGSHKYKGKALLDKLDVLARKSFFYEENSKNSKYENDMIW
YLWSGPFSPLFGKEKMTTFERYFIDDKKTHYEKKDPYYHYRDDEDICINILREFGLDSEQ
AHIINGHVPVESKNGENPIKANGKLIVIDGGFSKAYQSKTGIAGYTLIYNSFGLQLVSHE
LFETTEKAIKEETDIISSTVIFEKSVRRKRVGDTDIGKDLKKQLYELNLLLLAYKKGLIK
EFVKS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctattagaaagtaacaccaaaaacgaagaaattaaggacaatttaaagtacttagtt
cttctttcgaaacagtacccaacaattaacgaagcagctacggaaataatcaatctacag
gctattttaaacctacctaaaggaacggaacactttttatcagatgttcatggggaatat
gaacaattcatacatgtacttaagaacgcctctggagtaataaaaagaaaaatagacgat
attttcggaaatagacttatgcagagtgaaaagaaaagtcttgctacgttgatttattat
ccggagcagaagctggatataatattaaagcaggaaaaaaatattgatgactggtataaa
ataacactgtataggcttatagaggtttgcaggaatgtctcctcaaagtatactcgttct
aaagtaagaaaagctcttcctaaagaattttcgtatataattgaggagcttttgcatgaa
caacccaagggagtagataagcaggaatattatgacgagataataaagactattataagc
atagatagggctaaggagtttataactgcaatatcaaagcttatacagaggcttgtagta
gatagacttcacataataggtgatatctttgatagaggtccaagggcggatattataatg
gataagcttgaagagtatcatgcggtagatattcaatggggaaatcatgatattttatgg
atgggagctgcatccggttcttcagtatgcatggcaaatgtaataagaatttctgcaaga
tatgcaaatctgtcaactatagaagatggttacggaattaatttgttgccattagccact
tttgctatggacttttacggaaacgataagtgcaagaattttgaacctaagatagaatct
gataaaagttatacagtcaaggaaattgaacttataggtaaaatgcataaggctattgcg
ataatacagtttaagcttgaaggagaagctataaaaagacatcctgagtttaagatggaa
cataggatgcttctaaacaaaatcaactttgaagacagtaccatagaattggatggtaaa
aagtataaattaaatgatacaagctttccaactatagataaaaatgatccatataaactt
atagatgaggagagggaggtagttgaaaaattaagatcttcatttgtaaatagtgagaaa
ctaaacaggcatgtaaggtttttattttctcatggaaatctgtacctaaaatttaactct
aatttgttataccatggctgtatacctttaaatgaggacggaacctttaaagaggtgtta
ataggaagtcataagtataagggaaaggcacttttagataaacttgatgttttagctaga
aaaagctttttttatgaagaaaattctaaaaacagtaagtatgagaatgatatgatatgg
tatctttggtcaggccctttttcgccactttttggtaaagaaaaaatgacaacatttgaa
agatattttattgacgataagaagacacattatgaaaagaaagacccatattatcattac
agagatgatgaagatatatgtatcaatattttaagggaatttggacttgattctgagcaa
gctcatattataaatgggcatgttcctgtagaaagtaaaaatggagaaaatccaataaag
gcaaatgggaaattaatagttattgatggagggttttcaaaggcatatcaaagtaaaact
ggaatcgctggatataccttaatatataactcttttggacttcaacttgtatcacatgaa
ctgtttgaaacaactgaaaaagcaataaaagaagaaacagatataatatcttctactgtt
atatttgaaaaatcggtaagaagaaaaagagtaggagatactgatatagggaaagatttg
aaaaagcagctctatgagttgaacctattgcttttagcttataagaaggggcttattaag
gaatttgtaaaaagttaa

DBGET integrated database retrieval system