KEGG   Clostridium acetobutylicum ATCC 824: CA_C1572Help
Entry
CA_C1572          CDS       T00056                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00010  Glycolysis / Gluconeogenesis
cac00030  Pentose phosphate pathway
cac00051  Fructose and mannose metabolism
cac00680  Methane metabolism
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01130  Biosynthesis of antibiotics
cac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C1572
   00030 Pentose phosphate pathway
    CA_C1572
   00051 Fructose and mannose metabolism
    CA_C1572
  Energy metabolism
   00680 Methane metabolism
    CA_C1572
Enzymes [BR:cac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CA_C1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-GeneID: 1117755
NCBI-ProteinID: NP_348199
UniProt: Q97IR8
Position
1716058..1718055
Genome map
AA seq 665 aa AA seqDB search
MLLESNTKNEEIKDNLKYLVLLSKQYPTINEAATEIINLQAILNLPKGTEHFLSDVHGEY
EQFIHVLKNASGVIKRKIDDIFGNRLMQSEKKSLATLIYYPEQKLDIILKQEKNIDDWYK
ITLYRLIEVCRNVSSKYTRSKVRKALPKEFSYIIEELLHEQPKGVDKQEYYDEIIKTIIS
IDRAKEFITAISKLIQRLVVDRLHIIGDIFDRGPRADIIMDKLEEYHAVDIQWGNHDILW
MGAASGSSVCMANVIRISARYANLSTIEDGYGINLLPLATFAMDFYGNDKCKNFEPKIES
DKSYTVKEIELIGKMHKAIAIIQFKLEGEAIKRHPEFKMEHRMLLNKINFEDSTIELDGK
KYKLNDTSFPTIDKNDPYKLIDEEREVVEKLRSSFVNSEKLNRHVRFLFSHGNLYLKFNS
NLLYHGCIPLNEDGTFKEVLIGSHKYKGKALLDKLDVLARKSFFYEENSKNSKYENDMIW
YLWSGPFSPLFGKEKMTTFERYFIDDKKTHYEKKDPYYHYRDDEDICINILREFGLDSEQ
AHIINGHVPVESKNGENPIKANGKLIVIDGGFSKAYQSKTGIAGYTLIYNSFGLQLVSHE
LFETTEKAIKEETDIISSTVIFEKSVRRKRVGDTDIGKDLKKQLYELNLLLLAYKKGLIK
EFVKS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctattagaaagtaacaccaaaaacgaagaaattaaggacaatttaaagtacttagtt
cttctttcgaaacagtacccaacaattaacgaagcagctacggaaataatcaatctacag
gctattttaaacctacctaaaggaacggaacactttttatcagatgttcatggggaatat
gaacaattcatacatgtacttaagaacgcctctggagtaataaaaagaaaaatagacgat
attttcggaaatagacttatgcagagtgaaaagaaaagtcttgctacgttgatttattat
ccggagcagaagctggatataatattaaagcaggaaaaaaatattgatgactggtataaa
ataacactgtataggcttatagaggtttgcaggaatgtctcctcaaagtatactcgttct
aaagtaagaaaagctcttcctaaagaattttcgtatataattgaggagcttttgcatgaa
caacccaagggagtagataagcaggaatattatgacgagataataaagactattataagc
atagatagggctaaggagtttataactgcaatatcaaagcttatacagaggcttgtagta
gatagacttcacataataggtgatatctttgatagaggtccaagggcggatattataatg
gataagcttgaagagtatcatgcggtagatattcaatggggaaatcatgatattttatgg
atgggagctgcatccggttcttcagtatgcatggcaaatgtaataagaatttctgcaaga
tatgcaaatctgtcaactatagaagatggttacggaattaatttgttgccattagccact
tttgctatggacttttacggaaacgataagtgcaagaattttgaacctaagatagaatct
gataaaagttatacagtcaaggaaattgaacttataggtaaaatgcataaggctattgcg
ataatacagtttaagcttgaaggagaagctataaaaagacatcctgagtttaagatggaa
cataggatgcttctaaacaaaatcaactttgaagacagtaccatagaattggatggtaaa
aagtataaattaaatgatacaagctttccaactatagataaaaatgatccatataaactt
atagatgaggagagggaggtagttgaaaaattaagatcttcatttgtaaatagtgagaaa
ctaaacaggcatgtaaggtttttattttctcatggaaatctgtacctaaaatttaactct
aatttgttataccatggctgtatacctttaaatgaggacggaacctttaaagaggtgtta
ataggaagtcataagtataagggaaaggcacttttagataaacttgatgttttagctaga
aaaagctttttttatgaagaaaattctaaaaacagtaagtatgagaatgatatgatatgg
tatctttggtcaggccctttttcgccactttttggtaaagaaaaaatgacaacatttgaa
agatattttattgacgataagaagacacattatgaaaagaaagacccatattatcattac
agagatgatgaagatatatgtatcaatattttaagggaatttggacttgattctgagcaa
gctcatattataaatgggcatgttcctgtagaaagtaaaaatggagaaaatccaataaag
gcaaatgggaaattaatagttattgatggagggttttcaaaggcatatcaaagtaaaact
ggaatcgctggatataccttaatatataactcttttggacttcaacttgtatcacatgaa
ctgtttgaaacaactgaaaaagcaataaaagaagaaacagatataatatcttctactgtt
atatttgaaaaatcggtaagaagaaaaagagtaggagatactgatatagggaaagatttg
aaaaagcagctctatgagttgaacctattgcttttagcttataagaaggggcttattaag
gaatttgtaaaaagttaa

DBGET integrated database retrieval system