KEGG   Clostridium acetobutylicum ATCC 824: CA_C2018Help
Entry
CA_C2018          CDS       T00056                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA_C2018
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CA_C2018
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CA_C2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2128927..2130981)
Genome map
AA seq 684 aa AA seqDB search
MNSKVIDNNIVYINLSEKKVTYERITCEYRKKYIGGTGINTKILFESEAMYNDALSEKNV
LIFGAGAAVGTSLLTGNRSTITAKSPLTDIYGDSNIGGSFPTTMRSVGIDHLVFQGKSEN
PIYIFIDEKGNVKFEDASDLWGFYTDKTTDILSKRHNNCEISCIGPAGENLIRYASVFMS
KTHVAGRMGMGCIMGSKKLKAIVIERKKCEVPMYNREKIRSISKLWIEQSHTSIQFKVMG
LSGTLLLMDKYGEAKCLPVENAQRGYDKKCENLSPMVFKKEFETKKVPCKFCTLGCGKAY
EIKKGKYKGEKGERIEYGSATSFGPNVGIYDYSDVLHLKLLCDKLGMDTIEVAATIALIL
ECQKRGVLREDITEGRKFQFGNVDDIEYLMHKISDRSGIGDILAEGAYRASKTLKVEKYA
FCIKKASTGLHSNQKKAWSLGYITSTRGGDHLKDFPFTSVFSNPLTDSLGTHIFKRKFKG
TLSKDKEQGRVVWWHENYKYVIDSLGICLFCMQSITPQGHAFFDEFAEILSALFNIEVTK
EDMFYAGERIYQLQNAFNINCGMKLEDYKWPSREKEEDIEDEFIKDSTIEVRDSPGMLPE
YFYFRGLSSEGFPTTKRFKELQLDEYIERIKVDDSAITDSFENLLLKVSLNVNLKFMEKL
IGRLVYKIVAKKIDKQVALLNQNK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaagtgatagataataatatagtgtacataaacctatctgaaaaaaaggtg
acatacgagagaataacttgtgaatatagaaagaagtatattggaggaactggtataaat
acaaaaatactttttgagtctgaagctatgtataatgatgctttatcagaaaaaaatgta
ttgatatttggtgcaggtgctgcagttggtacaagtctccttacaggtaatcgtagtaca
ataactgctaaaagtccattaacagatatatacggagattctaatataggaggaagtttt
ccaacaactatgagatcagttggaatagatcacttagtatttcaaggtaaatcagaaaat
cctatatatatttttatagacgaaaagggtaatgttaaatttgaagatgcttctgattta
tgggggttctatacagataaaactacagatattttgtcgaagaggcataataattgtgaa
atatcatgtataggtcctgctggtgaaaatttgatacgttatgcaagcgtatttatgtca
aaaacacatgtagctggacgcatgggcatgggatgtataatgggatcaaagaaattaaaa
gctattgtaattgaacgcaaaaaatgtgaagttcctatgtataatagggaaaaaatcaga
tctatatcgaagctttggatagaacaaagtcatacatcgattcaattcaaggtaatgggt
ctcagtggtacgttattactaatggacaaatatggtgaagctaaatgtctgccagttgaa
aatgctcaacgaggctatgataaaaaatgcgaaaatttatcacctatggtatttaagaaa
gagtttgaaactaagaaagtgccatgtaaattttgtacattaggatgtggaaaagcttat
gaaattaaaaagggaaaatataagggtgagaaaggcgaaagaatagaatatggttctgca
accagttttggacctaatgttggtatatatgattattcagatgtgctgcatttaaaatta
ttatgcgataagctgggaatggatactatagaagtagcggctacaatagctctgatttta
gaatgtcaaaaacgtggagttttaagggaagatattactgaaggcagaaaatttcaattt
ggaaatgtggatgacatagaatatcttatgcataagataagtgatcgttctggaataggt
gatatacttgccgaaggtgcatacagagcatctaagacactgaaggttgaaaaatatgca
ttttgtataaaaaaggcgtcaacaggacttcattccaatcaaaaaaaagcatggtcttta
ggttatattacatctactcgaggcggagatcatttgaaggattttccgtttacatcagtt
ttttctaatcctcttacagattcattgggcacacatatatttaaaagaaagtttaaaggt
actttaagtaaagataaggaacagggaagagttgtgtggtggcatgaaaattataaatat
gtaattgattctttaggaatttgtttattttgtatgcagagtattacaccacagggacat
gcattctttgatgaatttgcagaaatattaagtgcattatttaatattgaggttacaaaa
gaggatatgttttatgcaggtgaaaggatttatcagcttcaaaatgcttttaatataaat
tgcggaatgaagcttgaggattataaatggccatcaagagaaaaagaagaagatattgaa
gatgaattcattaaagattcaacaattgaagtaagggattcaccaggaatgttgccagag
tatttctattttaggggattaagcagtgagggatttcctactactaaacgttttaaggaa
ctgcagctagatgaatatatagaaagaattaaagtagatgatagtgcaattacagattca
tttgaaaacttattattaaaagtaagtttgaatgtaaatcttaagttcatggagaagcta
ataggtcgcttagtatataaaatagttgcaaaaaaaatagataaacaagttgctttatta
aatcaaaataagtaa

DBGET integrated database retrieval system