KEGG   Clostridium acetobutylicum ATCC 824: CA_C2222Help
Entry
CA_C2222          CDS       T00056                                 

Gene name
cheB
Definition
methylesterase CheB/methylase CheR
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CA_C2222 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CA_C2222 (cheB)
Enzymes [BR:cac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CA_C2222 (cheB)
Two-component system [BR:cac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CA_C2222 (cheB)
Bacterial motility proteins [BR:cac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CA_C2222 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2312620..2313657)
Genome map
AA seq 345 aa AA seqDB search
MEKIKVIVVDDSVLMRRLICDMLESNDNIEVIGTAINGQDLLNKLKVMKPDVITLDIEMP
VMNGIETLKAVKSLKIDIPIIVFSSISQKGMKYTMECLYLGAFDFIPKPEKPFELSKMKD
DLIKRIRVAYSQNTNKNPAPINPVIRRETNRISSDSIEAVVIGASTGGPKALYKVITKFP
KDMNVPVFVVQHMPVGFTKAFADRLNDNSAIEVKEATDGETYRKGVVYVAPGGYHMEVDS
NSRIKLTKEPPIWGVRPAVDKLFISASKIFKSHIVSAVLTGMGKDGSNGTGIIKDNGGVT
ISESETTCVIYGMPKAAFETGKVDLVVPIDNVADEIIKIVRGLRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaagttattgtggtagatgattcagtgcttatgagaagattaatatgt
gacatgttagaaagtaatgataatattgaagttattggtactgcaataaatggacaggat
ttgttaaataagttaaaggttatgaaaccagatgttataactttagatatagaaatgccg
gttatgaatggtattgaaactcttaaagctgttaaatcattaaaaattgacataccgata
atagtgtttagtagtatttctcaaaaagggatgaagtacactatggaatgtctttattta
ggggcctttgattttattccaaagcctgaaaagccatttgaactttctaagatgaaggat
gatctcataaaaagaataagggtagcatatagccaaaatacaaataagaatcctgcacca
attaatcctgttataaggagggaaacaaatcgtataagtagtgatagcatagaagcagta
gttataggagcatctacaggtggacctaaagcattgtataaagttattacaaagtttcct
aaagatatgaatgttccagtatttgttgttcaacatatgcctgttggttttacgaaagct
tttgcagatagacttaatgataatagtgcaatagaagtaaaagaggcaacagatggagag
acttatagaaagggagttgtttatgtagctcctggaggatatcatatggaagtagattca
aattcaagaataaagcttaccaaagaaccgcctatatggggagtaagaccggcagtggat
aaactatttatttctgcttctaaaatttttaaatcccatatagttagtgctgtgttaacg
ggaatgggtaaggatggatctaatggaacaggaattattaaagataacggtggtgtaact
atttcagaatctgaaacaacatgtgttatatatggaatgcctaaagcagcatttgaaact
ggaaaggtggatcttgttgttccaatagataatgtagctgatgagataataaaaatagta
agaggtcttaggaggtag

DBGET integrated database retrieval system