KEGG   Clostridium acetobutylicum ATCC 824: CA_C2243Help
Entry
CA_C2243          CDS       T00056                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CA_C2243 (asnB)
Enzymes [BR:cac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CA_C2243 (asnB)
Peptidases [BR:cac01002]
 Cysteine Peptidases
  Family C44
   CA_C2243 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2338031..2339224
Genome map
AA seq 397 aa AA seqDB search
MCGIAGFVNFKKNLIDKKSIIEDMTNTLIKRGPNEKGYYISKNALLGHRRLIVVDPKGGS
QPMIKIHNGKKYIIVYNGELYNTEDIRKELLEAGYEFSSYSDTEVLLTSYIHWKEDCVNH
INGIFAFAIYSETDKKIFLARDPLGVKPLFYTIKNNNLIFGSEIKTLLANPLVEPILTKE
GLTEIFALGPARNLGSGVLKDIHEIPPANFIEFTEHKFKLHEYWRLSCKPHTENASETAE
HIKFLLTDAIKRQLYADVPVCTFLSGGLDSSIISAVAASEFKKHGKTLNTYSIDYKDNNL
YFKNDNFVITPDSVWAEKMRKFIGSNHHKIINNNLDLASALYDAVKANDIPGMADIDSSL
FLFCKGVAEKNVVSLSGERAIQMITNLVKQFINIGEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagctggatttgttaatttcaaaaaaaacttgattgacaaaaaaagtatt
atagaagatatgactaatactcttataaagagggggccaaatgaaaaaggctactatata
tcaaaaaatgctcttttgggccacagacgtcttatcgttgtagaccctaaaggtggtagt
caaccaatgataaaaatacacaatggaaaaaagtatattatagtttataatggcgagtta
tataatactgaggacatacgaaaggagcttttagaagcaggttatgaattttcatcatac
tctgatacagaagttcttttaacttcctacattcattggaaagaagattgcgtaaatcat
ataaatggaatttttgcttttgcgatatactctgaaactgataaaaaaatttttcttgca
agggatccattaggagtaaaacctttattttatacaataaaaaataacaacttaatattt
ggatctgaaataaaaactcttcttgcaaatcctcttgttgaaccaattttaacaaaagag
ggtttaacagaaatttttgcactaggtcctgctagaaatctcggcagtggagttttaaaa
gatattcatgaaattccacctgcaaactttatagagtttacggagcacaaattcaagctt
catgaatattggcgcttaagctgtaagcctcatactgaaaatgcaagtgaaacagcagag
catataaagtttcttcttacagatgcaataaaacgtcaactatatgcagacgtacccgta
tgtacttttctttcaggaggacttgactccagcataatttcagctgtagctgcaagtgaa
ttcaaaaaacatggaaaaactttaaatacttattctattgattataaagataataaccta
tactttaaaaacgataactttgtaataactcctgatagtgtctgggctgaaaaaatgcgt
aaatttataggcagtaatcatcacaaaataataaataataatttagatttagcatctgca
ttatatgatgctgtaaaggcaaatgacattcccggtatggccgacatagactcttctctc
tttttattctgtaaaggtgttgctgaaaaaaatgtagtttcactatcaggtgaacgtgca
atacagatgataactaatctagttaaacaatttataaatataggggagttataa

DBGET integrated database retrieval system