KEGG   Clostridium acetobutylicum ATCC 824: CA_C2246Help
Entry
CA_C2246          CDS       T00056                                 

Definition
lysophospholipase L2 PLDB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CA_C2246
Enzymes [BR:cac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CA_C2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2340515..2341606)
Genome map
AA seq 363 aa AA seqDB search
MRKLSKKVFLIFAVTTIFILGNSAWDRTIASEEDNSMIDGKPKEYYISEKNYKREIKQVE
NYLSARRESGHFIGKENIDIYYEKYVIPNSKNSIVISHGFRESMVKYNETIYYFLKNGYS
VYGLEHRGHARSGRLGKDSTQTSVDNFDYYVDDFKKYVDTIVEPDNRGKNLFLYAHSMGG
AIGGLFLERYPKYFKAAVLSSPMFEVDTGRYPEFLSRAVASVFNFVNLGDTYAPGHHEYS
CESDFENSCTTSNIRYDYYLDKTNKSRKIENGGASFKWVKESLKATDEVTDGKNASKVTI
PVLLFQAENDDIVRPGGQDKFAKEAKKCKLIVIKNSKHEIYREKDSIMVPYFNKVFTFLN
NNK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagttaagtaagaaggtttttttgatttttgctgtaacaacaatttttattctt
ggaaattcagcttgggataggaccatagcatctgaagaggataattctatgattgatgga
aaacctaaagagtattatataagtgaaaaaaactataaaagagaaataaagcaagttgaa
aattatcttagtgctaggcgagaatcagggcattttattggaaaggaaaatatagatatt
tactacgaaaaatatgttataccaaattcaaagaattcaattgtaatatcccatgggttt
agggagagtatggtaaagtataatgaaacaatatattattttttgaaaaatggatattcc
gtatatggattggaacatagaggccatgcaagatcaggtagattaggaaaagattcaaca
caaacaagtgtagataattttgattattatgtagatgattttaaaaaatatgttgatact
atagtagaaccggataatagagggaaaaatttattcttatatgcacattctatgggagga
gcaattggaggcttatttctagaaaggtatcctaaatatttcaaagccgcagttttaagt
tctccaatgtttgaggtagatacgggaagataccctgaatttttgtcaagagctgttgca
agtgtatttaactttgtgaatttaggagatacatatgctcctggtcaccatgagtattct
tgtgaatcggattttgaaaattcctgcacaacaagtaatattagatatgattattattta
gataaaactaacaagagtagaaaaattgaaaatggtggagcttcgtttaagtgggtaaag
gaatctttaaaggcaacagatgaggttacagacggaaaaaatgcatcaaaagtaactatt
ccagtgttgttatttcaagccgaaaatgatgatatagtaaggccaggaggacaagataag
tttgcaaaagaagctaagaagtgtaaactaatagtgattaagaattcaaagcatgaaata
tatagagaaaaggatagtataatggttccatatttcaataaggtatttacttttcttaat
aacaataagtag

DBGET integrated database retrieval system