KEGG   Clostridium acetobutylicum ATCC 824: CA_C2250Help
Entry
CA_C2250          CDS       T00056                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00040  Pentose and glucuronate interconversions
cac00052  Galactose metabolism
cac00500  Starch and sucrose metabolism
cac00520  Amino sugar and nucleotide sugar metabolism
cac01100  Metabolic pathways
cac01130  Biosynthesis of antibiotics
Module
cac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CA_C2250
   00052 Galactose metabolism
    CA_C2250
   00500 Starch and sucrose metabolism
    CA_C2250
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C2250
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CA_C2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD XET_C DUF1043
Motif
Other DBs
NCBI-GeneID: 1118433
NCBI-ProteinID: NP_348867
UniProt: Q97GW5
Position
complement(2344542..2345405)
Genome map
AA seq 287 aa AA seqDB search
MSIRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAALSGIEEILIIIGRNK
KSIEDHFDKSAELEEELKNNHKEELLRMVRQVSNMVNIYYVRQKEPMGLGHAISLAKSFA
GNEAFAVMLGDDIVDSKVPCLKQLMDCYDRYNTSILGVQEVRKKDVCKYGIVDGINIENK
ICKVKNLVEKPSIEMAPSNIAILGRYIITPTIFPILENTKPGKGGEVQLTDALEELLKRE
AIYSYCFDGKRYDIGDKLGFIEANIDFALKNDKLNSELKEYLLNINK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcataagaaaagctgtgattccagcagcaggtttaggaacaaggttccttccagct
acaaaagctcagccaaaggaaatgttacctatagttgataaacctacaatacagtatata
gttgaagaggcagctttatcaggaattgaagaaatacttataataattggaagaaataaa
aaatcaatagaagatcattttgacaaatcggcagagcttgaagaagaactaaaaaataac
cataaggaagaacttcttcggatggttaggcaggtaagtaatatggttaacatatactat
gtgcgccaaaaggagcctatgggattaggacatgctattagtttggcaaaaagttttgca
ggaaatgaagcttttgcagttatgcttggggacgatatagtggacagtaaagtcccctgt
ttaaagcagcttatggactgctatgatagatataatacgtctatattaggagttcaggaa
gtaagaaagaaggatgtttgtaaatatggaattgtggatggaataaacatagaaaataaa
atatgcaaggtcaaaaatttagttgaaaagcctagtatagaaatggcaccttctaatata
gctattcttggaaggtatattataacgccaactatatttcctatactggaaaatacaaaa
cctggaaaaggtggagaagttcagcttacagatgcattagaagaattgctaaagagagaa
gcaatatattcatattgttttgatggcaaaagatatgatattggagataaacttggattt
atagaggcaaatatagattttgcacttaaaaatgataaactaaacagtgaacttaaggaa
tatctactcaacataaacaaatag

DBGET integrated database retrieval system