KEGG   Clostridium acetobutylicum ATCC 824: CA_C2335Help
Entry
CA_C2335          CDS       T00056                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CA_C2335
   00052 Galactose metabolism
    CA_C2335
   00500 Starch and sucrose metabolism
    CA_C2335
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C2335
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CA_C2335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2442463..2443374)
Genome map
AA seq 303 aa AA seqDB search
MRVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILVITGRNK
RAIEDHFDKSFELESELESHNKKELLKVVKDISNLANIYYIRQKEPRGLGHAINCARTFV
GNEPFAVLLGDDVVNAKVPCLKQLINCYNEYKTSILGVQRVPNSEVSKYGIVNGMHIEDG
VYKVKDLVEKPKQEEAPSDLAILGRYIITPSIFDILDNTKPGKGDEIQLTDALKTLMKTE
AMYAYVFSGRRYDVGDKLGFLQATVEYALKREELKKPFMNYLFTIKDNPNFKSLYDELNK
KSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaaaaaagctataataccagcagcggggttaggaacaagatttttaccagca
actaaggcacaacctaaggaaatgcttcctatagttgataagcctacaatacagtatata
attgaagaagcagtacaatcaggaatagaagaaatacttgttattacaggaagaaacaaa
agagctatagaggatcattttgataaatcatttgaacttgaaagtgaacttgagagtcat
aacaaaaaagaacttcttaaggttgtaaaagatatatctaatttagctaatatatactat
atacgtcagaaggaaccaagaggccttggacatgcaattaattgtgctagaacttttgta
ggtaatgaaccatttgcagttttattaggtgatgatgtagtaaatgcaaaggtaccatgc
ttaaagcaacttataaattgttataatgagtataaaacttccatattaggagttcaaagg
gtgcctaattcagaggtgtcaaaatatggtatagtaaatggcatgcatatagaagatgga
gtttataaggtaaaggatttggttgaaaagccaaaacaagaagaagcaccttccgattta
gctatactaggaagatacataataactccatctatatttgatatattagataacactaaa
ccaggtaagggtgatgaaattcaacttacagatgcacttaaaacacttatgaaaacagaa
gcaatgtacgcttatgtattctcaggaagacgatatgatgttggagataaattaggtttc
cttcaagctacagttgagtatgcattaaagagagaagagcttaaaaaaccatttatgaac
tatttatttactataaaagataatcctaattttaaatctttatatgacgaattaaacaaa
aagagtaaatag

DBGET integrated database retrieval system