KEGG   Clostridium acetobutylicum ATCC 824: CA_C2514Help
Entry
CA_C2514          CDS       T00056                                 

Definition
beta galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CA_C2514
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CA_C2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2621016..2623964)
Genome map
AA seq 982 aa AA seqDB search
MNNNFKKVLMCLLGVGIYISAVTFPSKIYADTIQKKISRNNNDSFTLPSSQGLKGIHNVS
YDHYSLMIDGKRIFLYSGEFDYWRLPSQSGWMDVLEKMKAAGFNAVTIYFNWGFHSPKQG
KYDFSGIRDVDKLLTMAQKIGLYVVARPGPYINAETDGGGYPGWLTTQQGRARTASQDYT
AAYEQWLSAIDPIIEKHQITNGGSVILYQVENEYTGGDALYMQNIRDKARKDGINVPTFH
NDKSGPKGRWSSGTGAPDMYAYDSYPGLAAIPSYYGDPRKFAPNSPVFLAELGGGWFDPW
GGKSYAILSKNYNANYENVLYNHVVSEGATMMSIYMTYGGTNWGYLPFPGVYSSYDYTAA
ISESRQLGSKYNEEKLLATMYRTLTPLTKTDPLTTIEAPSNPNLLANAIENSDTKTQFYI
LRHSNGSSISNDNTTLKIQSADGIYILPQEPGTSININGQESKFIVANFQLGSEHLVYST
SNLYTYVTQGNRDTAIFYGGQESDGETVLRYKNQPKVTVLCGNVKSRYDSVSGDLRLNYK
HDGSISRVMIKDDNKELMLLFTTDITAQTFWCEDTSIGEILVRGPYLVRSASIRDRNKLE
LQGDTDKASDIEVFAPTSVNEIKWNGEKVKALQTSYLSYTFSLLSPEQVLIPVITNWKYS
YETNEAQSEFDDSSWISANKTTTNNPVKPLTPTVLYADDYGFHHGVVWFRGHFKASGKET
GIILDGEGGTNGAYAVWINGFYLGASLSGIKNFTFPKNVLKTSDDNVISVMVQNMGHDED
GGCKDTHKSPRGLVQASLQGDTTSIFWSIQGNKGGETLIDPVRGAMNAGGLYGENNGWTL
PNFPDKPWKQVTLPDNGKQRGVAPGVSWYRTTFKLNFPKMSDVPLALYIKDNNTKNYRAY
IYVNGWLIGQYINSLGPQNLFSLPSGVLDPNGKNTIAIAVWALDNNSTGLGEIILQKLGN
YSGGVPVKMNDNPSYKDVFNKN
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atgaataataattttaaaaaagtacttatgtgtttactcggcgttggtatttatatatca
gcggtaacgttcccttcaaaaatatatgctgatactatacagaagaaaatatcacgcaac
aataatgattcatttactttgccatcatctcaaggattaaaaggaattcataatgtttcg
tatgatcactattcgttgatgattgatggaaaaagaatttttctttattctggtgagttt
gattattggcgtttaccaagtcaatctggctggatggatgttttagaaaaaatgaaagca
gctggttttaatgctgttaccatttactttaactggggttttcattctcctaaacaaggg
aaatacgatttttctggaattcgcgatgttgataaactccttactatggcacaaaagatt
gggttatatgtagttgcaagaccaggtccatatattaatgcagaaactgacggaggagga
tatccaggttggttaacaacacagcagggaagagcgcgtactgcttcacaagattatact
gctgcctatgaacaatggctgagtgctattgatccaattattgaaaagcatcaaattaca
aatggaggaagcgtaattttgtaccaagtggaaaatgagtatacaggtggagatgccttg
tatatgcagaacattagagacaaagcacgtaaggatggaattaatgtaccaacttttcat
aatgacaaaagtgggccaaaaggaagatggtctagtggaactggtgcaccagatatgtat
gcatatgacagttaccctggactagcggcaattccatcatattacggagatccgcgtaaa
tttgcaccaaatagtccagtgtttttagcggaactaggaggtgggtggtttgatccttgg
ggaggaaagagttacgctatactttctaaaaattataatgctaattatgaaaacgtttta
tacaaccatgttgtatctgaaggagcaactatgatgagtatttacatgacttatggtgga
acaaattgggggtatttgccttttccaggtgtgtactcttcctatgattatacagcggca
ataagtgagagccgtcagcttggatcaaagtataatgaagaaaagctacttgcaactatg
tacagaacgcttacccctcttacaaagacagatccattaacaaccatagaagctccaagt
aatcctaatttattagctaatgcaattgaaaattcggatacaaaaactcagttttatata
ctgcgtcatagtaatggttcctcaattagtaatgataatacgactttgaaaattcagagc
gcagatggcatttatatacttccacaagaacctggtacatcaatcaatataaatggacaa
gaatctaaatttatagttgctaattttcaacttgggtcagagcatttagtgtattcaact
tctaatttatatacttatgttacacaaggaaatagagacactgctattttttacggagga
caagaatcggatggtgaaacagttcttcgttataaaaatcaacctaaagtgactgtttta
tgtggaaatgtaaagtcaaggtatgattctgtaagtggagacctacgcttaaattataaa
catgatggaagtatttcacgtgtaatgataaaagatgacaacaaagaattaatgctgctt
tttacaacggatataacggctcaaacgttctggtgtgaagatacttctataggagagatt
ttagttaggggaccttatttggtaagatctgcatcaatacgtgatagaaataaattagaa
ctacaaggtgatactgataaggcatcagatatagaggtatttgctccaacgtctgtcaat
gaaatcaagtggaatggtgaaaaagttaaagcattacaaacttcttatttatcatatact
ttttctctgttatcgccagaacaagtattaattccagttattacaaattggaagtactca
tatgaaactaatgaagcacagtcagaatttgatgattcatcttggataagtgcaaataaa
acaactacaaataatccggtaaagcctttaaccccaactgtattatatgcagatgattat
ggttttcatcacggagttgtttggtttagaggacactttaaggcaagtggaaaagaaaca
ggaattattttagatggagaaggaggaacaaatggagcatatgctgtgtggataaatggt
ttttacttaggtgcttcattaagcggaattaagaattttacatttcctaaaaatgtttta
aaaacaagtgatgacaatgtcatatcagtgatggtacagaacatgggacatgatgaagat
ggtggatgcaaggatacacataaaagcccacgtggacttgtgcaggcatcgcttcaagga
gatacaacatcaattttctggagtattcaaggaaataaggggggagagactttgatagat
cctgttagaggggcaatgaatgcgggtggattatatggtgaaaataatggttggacactg
cctaattttcctgataaaccatggaaacaagtaacactaccagacaatggaaagcaaaga
ggagtagcaccaggagtttcgtggtatagaactacattcaagttgaatttccccaaaatg
agcgatgttccccttgcactttatataaaggataataatactaaaaactatcgtgcttat
atttatgtaaatggatggcttattggtcaatatataaatagtttgggacctcagaattta
ttttcactgccctctggtgtattagatccaaatggtaaaaatactattgctattgcagtt
tgggcattagataataattcaacaggacttggagaaataattttacaaaagcttggtaat
tattcaggtggtgtaccagttaaaatgaatgataatccgagctataaagatgtttttaat
aaaaactaa

DBGET integrated database retrieval system