KEGG   Clostridium acetobutylicum ATCC 824: CA_C2613Help
Entry
CA_C2613          CDS       T00056                                 

Gene name
glcK
Definition
NagC/XylR family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA_C2613 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C2613 (glcK)
   00052 Galactose metabolism
    CA_C2613 (glcK)
   00500 Starch and sucrose metabolism
    CA_C2613 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C2613 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CA_C2613 (glcK)
   00524 Butirosin and neomycin biosynthesis
    CA_C2613 (glcK)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CA_C2613 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2717044..2717985)
Genome map
AA seq 313 aa AA seqDB search
MRTYGFGIDIGGTTIKMGLFRVDGTLLDKWEIPTRKEESGKYILSDISKEIKDKMKEKGI
HRNDVIGVGVGVPGPVSSDGTVLKCVNLGWGIFNVEETLSEMIDIPVKAGNDANIAALGE
MWQGGGKGYKNVVMVTLGTGVGGGIIINGNIISGANGAGGEIGHIKVEENEKDVCGCGKT
GCLEQYASANGIVREAKKLLNNSSEPSSLREIKTVTSKDIFDAAKEGDKLANELVEALGK
KLGNALATVSCVSDPEVFVVGGGVSKAGMILINVIQKNFIEKAFHACEGTKFELARLGND
AGIYGGVKLVLEI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatatggatttggaatagacattgggggaacaacaataaaaatgggtctattc
agagttgatggcactttacttgataagtgggagattcctactagaaaagaggaaagtgga
aagtatatattaagtgatatatcaaaagaaataaaagataagatgaaggaaaaaggaata
catagaaatgatgtaattggtgtaggagttggagtaccaggaccagttagcagcgatgga
accgttttaaaatgtgtgaacttaggatggggcatatttaatgtagaagaaactttaagt
gaaatgatagatattccagtaaaggctggtaatgatgctaatatagcagctttgggcgaa
atgtggcagggaggaggaaaaggctataaaaatgttgttatggttacacttggaacaggc
gttggcggaggaattataattaacggcaatataatttctggagcaaatggtgcaggtgga
gaaataggccatattaaagtagaggaaaatgagaaagatgtttgtggatgtggaaagaca
ggctgtcttgaacagtatgcctcagcaaatggaattgtaagagaagcaaaaaaactttta
aataatagtagtgaaccttcctctttgagagaaattaaaacggttacttcaaaggatata
tttgatgctgcaaaagaaggagataaattagctaatgaacttgttgaagctttaggaaaa
aaattaggtaatgcattagccacagtttcatgtgttagtgacccagaggtttttgttgta
ggtggaggagtatcaaaggctggaatgattcttataaatgtaattcagaaaaatttcatt
gaaaaggcatttcatgcatgtgaaggaactaagtttgagcttgcaaggcttggaaatgat
gcaggaatttacggcggagtaaaattagtattagagatataa

DBGET integrated database retrieval system