KEGG   Clostridium acetobutylicum ATCC 824: CA_C2613Help
Entry
CA_C2613          CDS       T00056                                 

Gene name
glcK
Definition
(RefSeq) NagC/XylR family transcriptional regulator
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00010  Glycolysis / Gluconeogenesis
cac00052  Galactose metabolism
cac00500  Starch and sucrose metabolism
cac00520  Amino sugar and nucleotide sugar metabolism
cac00521  Streptomycin biosynthesis
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01120  Microbial metabolism in diverse environments
cac01130  Biosynthesis of antibiotics
cac01200  Carbon metabolism
Module
cac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C2613 (glcK)
   00052 Galactose metabolism
    CA_C2613 (glcK)
   00500 Starch and sucrose metabolism
    CA_C2613 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CA_C2613 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CA_C2613 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CA_C2613 (glcK)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CA_C2613 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Pan_kinase
Motif
Other DBs
NCBI-GeneID: 1118796
NCBI-ProteinID: NP_349220
UniProt: Q97FW3
Position
complement(2717044..2717985)
Genome map
AA seq 313 aa AA seqDB search
MRTYGFGIDIGGTTIKMGLFRVDGTLLDKWEIPTRKEESGKYILSDISKEIKDKMKEKGI
HRNDVIGVGVGVPGPVSSDGTVLKCVNLGWGIFNVEETLSEMIDIPVKAGNDANIAALGE
MWQGGGKGYKNVVMVTLGTGVGGGIIINGNIISGANGAGGEIGHIKVEENEKDVCGCGKT
GCLEQYASANGIVREAKKLLNNSSEPSSLREIKTVTSKDIFDAAKEGDKLANELVEALGK
KLGNALATVSCVSDPEVFVVGGGVSKAGMILINVIQKNFIEKAFHACEGTKFELARLGND
AGIYGGVKLVLEI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatatggatttggaatagacattgggggaacaacaataaaaatgggtctattc
agagttgatggcactttacttgataagtgggagattcctactagaaaagaggaaagtgga
aagtatatattaagtgatatatcaaaagaaataaaagataagatgaaggaaaaaggaata
catagaaatgatgtaattggtgtaggagttggagtaccaggaccagttagcagcgatgga
accgttttaaaatgtgtgaacttaggatggggcatatttaatgtagaagaaactttaagt
gaaatgatagatattccagtaaaggctggtaatgatgctaatatagcagctttgggcgaa
atgtggcagggaggaggaaaaggctataaaaatgttgttatggttacacttggaacaggc
gttggcggaggaattataattaacggcaatataatttctggagcaaatggtgcaggtgga
gaaataggccatattaaagtagaggaaaatgagaaagatgtttgtggatgtggaaagaca
ggctgtcttgaacagtatgcctcagcaaatggaattgtaagagaagcaaaaaaactttta
aataatagtagtgaaccttcctctttgagagaaattaaaacggttacttcaaaggatata
tttgatgctgcaaaagaaggagataaattagctaatgaacttgttgaagctttaggaaaa
aaattaggtaatgcattagccacagtttcatgtgttagtgacccagaggtttttgttgta
ggtggaggagtatcaaaggctggaatgattcttataaatgtaattcagaaaaatttcatt
gaaaaggcatttcatgcatgtgaaggaactaagtttgagcttgcaaggcttggaaatgat
gcaggaatttacggcggagtaaaattagtattagagatataa

DBGET integrated database retrieval system