KEGG   Clostridium acetobutylicum ATCC 824: CA_C2819Help
Entry
CA_C2819          CDS       T00056                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cac00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2947625..2949076
Genome map
AA seq 483 aa AA seqDB search
MKLKQLLQNIDYDLIKGDININIEGISYNSKKVKQNYVFVSIKGARFDGHDFIKEAAQNG
AAAVIIDEDFHDSIENTTLVKVKNSKVALACLCNLFYEEPSRELNLVGVTGTNGKTTVIH
YIRDMLEAFGNSTGTIGTLGYELKDKEINVEKINPTTPEALELNQILRDFIDKGAKNAVM
EVTSSALMKHRVDYCSFKVGVFTNLSQDHLDEHGTIENYKNEKIKLFKMCPVGVINLDDN
IAGEIIEKGTCEFFTYGVLTNADLTASDMVYKPNSVSFNVHYKGISSKVKVNVPGEFTVY
NVLAAIGSLLCLGIDFESILKLVSSIKPVLGRLETINNPLNKNIIIDYAHTPDSLEKLLI
MAREMTNGRIITVFGCGGDRDKSKRGLMGMAVGILSDYCIITSDNPRHEKPEDIIRDIER
GMQTINSSYEKITDRRCAIKRGIEILKEEDILIIAGKGHEDYQIIGDNKVHFDDREVVNE
LLG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaacaacttttacaaaacatagattacgatttaataaaaggggacattaat
ataaatatagaaggaataagctataattctaaaaaggttaaacaaaattacgtttttgtt
tccattaaaggagcaagatttgacggtcatgatttcataaaagaagctgcacaaaatggg
gctgcggcagttattatagatgaagattttcatgattcaatagagaatacaaccttagta
aaagttaaaaattcaaaagtggctttagcttgcctatgcaatttattttatgaggagccc
tctagagaacttaacttggttggtgtaactggcaccaatggaaaaaccacagttatacat
tacataagagatatgcttgaagcctttggcaatagcactggtactataggaactcttggt
tatgagttaaaggataaagaaataaatgtagaaaaaattaatcctactacgccagaggct
ttagagcttaaccaaattttaagggactttatagacaagggtgcaaaaaacgctgtaatg
gaggtaacctcttctgctttaatgaagcatagagttgattattgcagttttaaagtaggc
gtatttacaaatctttctcaagatcatcttgatgaacatggcactatagaaaattataaa
aatgagaaaattaaattattcaaaatgtgtcctgtaggtgtaataaatctagatgacaat
attgcaggtgaaattattgaaaaaggaacttgtgaatttttcacctacggagttttaact
aatgcagatcttacagctagcgatatggtttataagcctaattccgtaagctttaatgtt
cattacaaaggtatatcctctaaagtcaaggtaaatgtacctggtgaatttactgtgtac
aatgttttagctgcaataggaagcctactttgcctcggcattgattttgaaagtatttta
aagcttgtttcaagcataaaacctgttttaggaagattagaaacaataaataatccatta
aataaaaatataataatagattatgctcatactcccgattctcttgaaaagcttcttata
atggctcgtgaaatgacaaatggcagaataataacagtatttggctgtggtggtgataga
gataaaagtaaaagaggtcttatgggcatggcagttggaatactttctgattactgcata
ataacctctgataaccctagacatgaaaagccagaggatataattagagatatagaacgc
ggcatgcaaactataaattcatcttatgaaaaaattacggatagacgctgtgcaattaaa
cgtgggattgaaatcctaaaagaagaggatatactaataatagctggaaaaggacatgaa
gactatcaaattattggagataacaaagtacactttgatgatagagaagttgttaatgaa
ttactaggataa

DBGET integrated database retrieval system