KEGG   Clostridium acetobutylicum ATCC 824: CA_C2926Help
Entry
CA_C2926          CDS       T00056                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
3058860..3059666
Genome map
AA seq 268 aa AA seqDB search
MKIANKDFILGERTYIMGILNVTPDSFSDGGKFNNLDNALKHAAKLIEDGADIIDIGGES
TRPNHSSVDKNEELERVIPIIEAVSHEFDIPISIDTYKGEVAEAALESGAHLINDVWGFK
KDTYMAKVAAKYDVPCCLMHNRENNDYSNFLQDVIDDLKESIDIAINAGVKPENIMIDPG
IGFAKDFNQNLLLMNNLEKLNVLNFPILLGTSRKSMIGNILNLPPNKRVEGTVATSVIGV
VKGCDFIRVHDVLENKRACMVADAIIRR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcgaataaagattttatacttggagaaagaacttacataatgggaatttta
aatgttacacctgattctttttctgatggaggaaaatttaataatttagacaatgcttta
aaacatgcagctaagctcatagaagatggcgctgatataattgatatcggtggtgaatcc
acaagaccaaaccactcttctgttgacaaaaatgaggaactagaacgggttattccaata
atagaagccgtatcgcacgaatttgatattccaatttctatagatacctataagggcgaa
gttgcagaggccgcattagaatctggtgcgcaccttataaatgatgtatggggtttcaaa
aaagatacatatatggctaaggtagctgcgaaatatgatgttccttgttgtctaatgcat
aatagagaaaataacgattatagtaactttcttcaagatgttatagatgatttaaaagaa
agtatagatatagcaataaatgctggtgttaaaccagaaaatataatgatagatcctgga
ataggttttgcaaaagacttcaatcaaaatttgcttttaatgaataatttagaaaaatta
aatgttttaaatttccctattcttttgggcacttctagaaaatcaatgataggcaatatt
ttaaatttgcctcccaacaaaagagttgagggtacagttgctacttcagtcataggtgta
gtcaaaggctgtgattttattagagttcatgacgttcttgaaaataaacgagcttgtatg
gtagctgatgcaataataaggagatga

DBGET integrated database retrieval system