KEGG   Clostridium acetobutylicum ATCC 824: CA_C2927Help
Entry
CA_C2927          CDS       T00056                                 

Gene name
folA_folK
Definition
dihydroneopterin aldolase fused to 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA_C2927 (folA_folK)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CA_C2927 (folA_folK)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     CA_C2927 (folA_folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
3059672..3060499
Genome map
AA seq 275 aa AA seqDB search
MDKITIEDLEIFANHGVLGEEKVLGQKFLLSLYLTLDLRKPGLSKTLSDTVNYAELSDRV
EEEFQRENFDLIETAAEKVAEFILLNYDLIQSVKVILKKPWAPVKKHLKYVSVEIERSWH
TVYIGLGSNIADKSQNLKDALKIIDDNYLCKITKTSNFYTTRPVGYLNQDNFLNCAAEVK
TLMTPNELMDFFLETEKSLKRERKIHWGPRTIDIDILLYDDLVTYDPHCTIPHPRMAERL
FVITPLCDINPYLVHPISNKRLINIKNVLSKTQSL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaaataactatagaagatcttgaaatatttgcgaaccacggtgttctaggagaa
gaaaaagtattaggacaaaaattcttattatctctataccttactttagatttaagaaaa
cctggattgtcaaaaactttgagcgatacagtaaattacgctgaactctctgatagagta
gaagaagaatttcagagggaaaatttcgatttaattgaaactgctgctgaaaaagtagcc
gagtttattttactaaattacgatttaattcaatctgtaaaagtaattttaaaaaaacct
tgggctcctgtaaaaaaacatttaaagtatgtttctgtagaaatagaacgaagttggcat
acagtttatataggccttggatcaaatattgcagataaatcacaaaatttaaaagatgct
cttaaaattatcgatgacaactatttatgcaaaatcacaaaaacttctaacttctatact
acaagacctgttggatatctaaaccaagataattttttaaactgcgctgctgaagtaaaa
actttaatgacaccaaatgagcttatggactttttccttgaaacagagaagtcgcttaaa
cgcgaacgaaaaatacattggggtcctcgaaccatagatattgatattttactttacgat
gatttagttacctatgatcctcactgcacaatcccccatcctagaatggcagaaagactt
tttgtcataactccattatgtgatataaacccatacttggttcatcctatatccaataag
agattaattaatataaagaatgtcttatcaaaaacacaatctctataa

DBGET integrated database retrieval system