KEGG   Clostridium acetobutylicum ATCC 824: CA_C3157Help
Entry
CA_C3157          CDS       T00056                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CA_C3157 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA_C3157 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA_C3157 (trpA)
Enzymes [BR:cac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CA_C3157 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3292089..3292880)
Genome map
AA seq 263 aa AA seqDB search
MANKIDLKFKELKYKNKKAMIPFVTSGYPDVETTKKIVIEMEKSGADLIELGIPYSDPVA
DGPIIQISSSGALNNGLKIKDIMNMVKEVRKNVKIPIVYMGYFGCVFKYGLEKFIKDSKE
SGVDGIVIPDLPLEERERVKEIADRYEFYIIPLVAPTSEDRIGKIVNGAKGFIYCVSTNG
VTGVRNIIANDVKAYIDVVSKASNVPKCIGFGISSPEMAQKMKEYCDGVIIGSAVMKIVE
EDIPKEEMIRKVGEFISQVNEVL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaaattgatttgaaatttaaggagttaaaatataaaaacaaaaaagctatg
attccatttgttacaagtggatatcctgatgttgaaacgacaaagaaaatagttattgaa
atggagaaatccggagctgatttaatagagcttggaataccttactcagatcccgttgca
gatggtcctattatacaaatatcttcatctggagctcttaataatggacttaagataaag
gatataatgaatatggtaaaagaggtacgtaaaaatgttaaaataccaatagtctatatg
ggatactttggatgtgtttttaaatatggattagagaagtttattaaagattccaaagaa
tctggcgtagatggaatagtaataccagatttacctcttgaagaaagagaaagggtgaaa
gaaatagcagacagatatgaattttatataataccacttgtagcacctacttcagaggat
agaataggtaaaatagttaatggggccaagggctttatatattgtgtttctactaatgga
gttactggagttagaaatattatagctaatgatgttaaagcttatatagatgtagtttca
aaagcttcgaatgtacctaaatgcataggcttcggcatatctagtccagaaatggcacaa
aagatgaaagaatattgtgatggagttattataggaagtgctgttatgaaaattgttgag
gaggatataccaaaggaagagatgattcgtaaagtaggagaatttatttcacaggttaat
gaagtattataa

DBGET integrated database retrieval system