KEGG   Clostridium acetobutylicum ATCC 824: CA_C3160Help
Entry
CA_C3160          CDS       T00056                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cac01100  Metabolic pathways
cac01110  Biosynthesis of secondary metabolites
cac01130  Biosynthesis of antibiotics
cac01230  Biosynthesis of amino acids
Module
cac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA_C3160 (trpC)
Enzymes [BR:cac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CA_C3160 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh Type2_restr_D3
Motif
Other DBs
NCBI-GeneID: 1119342
NCBI-ProteinID: NP_349757
UniProt: Q97EF3
Position
complement(3294661..3295449)
Genome map
AA seq 262 aa AA seqDB search
MILDDIVRDKKLQLIEDKKALSLDDIKSKLNSLNLDKRNFKEALEKENISIIAEIKKASP
SKGVIREDFNPVKIGQIYENINIDAVSILTEKKYFLGKNEYIKIVKEVNSKPILRKDFIV
DEYQLYEAKLIGADAVLLIAAVLKDKLECFYNRTLELGLDSITEVHNEEEAKLASEIGCS
IIGINNRDLRDFSTDITTTKRLMKYVPRDRIIVSESSIKTPEDILYLRSIGVNAVLIGET
FMRNIDDLKGINEFLKKAKDNG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
ttgatacttgatgatattgttcgtgataaaaagctccagcttatagaggataaaaaggcg
cttagcttagatgatataaaatcaaaattgaattctttaaatttagataagagaaatttt
aaagaagctctcgaaaaagaaaatatatctataatagcagaaattaaaaaggcatcacca
tctaagggagttataagggaagattttaatcccgtaaaaataggacaaatttatgaaaat
ataaacatagatgcagtgtcgattcttacggaaaagaaatatttcctgggaaaaaatgaa
tacattaagattgtaaaagaagtgaactctaaacccatacttagaaaggattttatagta
gatgaatatcaactttatgaagccaagcttataggagcagacgctgttttgttaatagca
gcagtacttaaagataagctggaatgcttttacaatagaacactggaacttggacttgat
tctataactgaggttcataatgaggaagaagcaaaattagcgtctgaaattggttgcagc
ataataggaataaacaacagagatttaagggatttttctacagatattacaactacaaag
aggcttatgaaatacgtaccaagggatagaataattgtttcagaaagctcaataaaaaca
ccagaagatatattgtatttgagatcaataggagtgaatgctgttttaataggtgaaacc
tttatgagaaatatagatgatttaaagggtataaatgaatttttaaagaaggctaaggat
aatggttaa

DBGET integrated database retrieval system