KEGG   Clostridium acetobutylicum ATCC 824: CA_C3626Help
Entry
CA_C3626          CDS       T00056                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA_C3626 (folE)
Enzymes [BR:cac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CA_C3626 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3827117..3827704
Genome map
AA seq 195 aa AA seqDB search
MSIDTKAIEKHIRGILIALGDDPDREGLKETPKRVAKMYEEVFKGMEYSNDDIAEMFNKT
FEEDLKESEEDNIVLVKDIEIFSHCEHHLTLMYNMTVAVAYIPNKRLIGLSKIARIADMV
SRRLQLQERIGKDIAEIMEKVTASKDIAVIIKGEHGCMTSRGIKKPGALTTTMTLKGRFK
NDDSLVTKLMALYKA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgatacaaaagcaattgaaaaacacataagaggaattcttatagcgttagga
gatgatcctgatcgtgaaggtcttaaggaaacaccaaaaagagtagccaaaatgtatgaa
gaagtatttaagggaatggaatactcaaacgacgatatagcagaaatgtttaataagacc
tttgaagaagatttaaaagaaagtgaagaggataacatagtccttgttaaagatatcgaa
atatttagccactgtgagcatcacctgacgcttatgtataacatgactgttgcagtagcc
tatataccaaacaagcgtctaattggcctcagtaaaatagctagaatcgctgatatggtt
tcaagaagacttcagcttcaagagagaataggtaaagacattgctgaaataatggaaaag
gtaactgcttcaaaagacattgctgtaattataaaaggcgagcacggctgtatgacctca
agaggtataaaaaagcctggagcattaactacaacaatgacacttaaaggaagatttaaa
aatgatgattctttagtaacaaaacttatggctttatacaaggcataa

DBGET integrated database retrieval system