KEGG   Clostridium acetobutylicum ATCC 824: CA_C3626Help
Entry
CA_C3626          CDS       T00056                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00790  Folate biosynthesis
cac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA_C3626 (folE)
Enzymes [BR:cac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CA_C3626 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-GeneID: 1119808
NCBI-ProteinID: NP_350209
UniProt: Q97D54
Position
3827117..3827704
Genome map
AA seq 195 aa AA seqDB search
MSIDTKAIEKHIRGILIALGDDPDREGLKETPKRVAKMYEEVFKGMEYSNDDIAEMFNKT
FEEDLKESEEDNIVLVKDIEIFSHCEHHLTLMYNMTVAVAYIPNKRLIGLSKIARIADMV
SRRLQLQERIGKDIAEIMEKVTASKDIAVIIKGEHGCMTSRGIKKPGALTTTMTLKGRFK
NDDSLVTKLMALYKA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgatacaaaagcaattgaaaaacacataagaggaattcttatagcgttagga
gatgatcctgatcgtgaaggtcttaaggaaacaccaaaaagagtagccaaaatgtatgaa
gaagtatttaagggaatggaatactcaaacgacgatatagcagaaatgtttaataagacc
tttgaagaagatttaaaagaaagtgaagaggataacatagtccttgttaaagatatcgaa
atatttagccactgtgagcatcacctgacgcttatgtataacatgactgttgcagtagcc
tatataccaaacaagcgtctaattggcctcagtaaaatagctagaatcgctgatatggtt
tcaagaagacttcagcttcaagagagaataggtaaagacattgctgaaataatggaaaag
gtaactgcttcaaaagacattgctgtaattataaaaggcgagcacggctgtatgacctca
agaggtataaaaaagcctggagcattaactacaacaatgacacttaaaggaagatttaaa
aatgatgattctttagtaacaaaacttatggctttatacaaggcataa

DBGET integrated database retrieval system