KEGG   Clostridium acetobutylicum ATCC 824: CA_P0035Help
Entry
CA_P0035          CDS       T00056                                 

Gene name
adhe
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CA_P0035 (adhe)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_P0035 (adhe)
   00620 Pyruvate metabolism
    CA_P0035 (adhe)
   00650 Butanoate metabolism
    CA_P0035 (adhe)
  Lipid metabolism
   00071 Fatty acid degradation
    CA_P0035 (adhe)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CA_P0035 (adhe)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CA_P0035 (adhe)
   00626 Naphthalene degradation
    CA_P0035 (adhe)
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CA_P0035 (adhe)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CA_P0035 (adhe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSOL1:complement(33722..36298)
Genome map
AA seq 858 aa AA seqDB search
MKVTNQKELKQKLNELREAQKKFATYTQEQVDKIFKQCAIAAAKERINLAKLAVEETGIG
LVEDKIIKNHFAAEYIYNKYKNEKTCGIIDHDDSLGITKVAEPIGIVAAIVPTTNPTSTA
IFKSLISLKTRNAIFFSPHPRAKKSTIAAAKLILDAAVKAGAPKNIIGWIDEPSIELSQD
LMSEADIILATGGPSMVKAAYSSGKPAIGVGAGNTPAIIDESADIDMAVSSIILSKTYDN
GVICASEQSILVMNSIYEKVKEEFVKRGSYILNQNEIAKIKETMFKNGAINADIVGKSAY
IIAKMAGIEVPQTTKILIGEVQSVEKSELFSHEKLSPVLAMYKVKDFDEALKKAQRLIEL
GGSGHTSSLYIDSQNNKDKVKEFGLAMKTSRTFINMPSSQGASGDLYNFAIAPSFTLGCG
TWGGNSVSQNVEPKHLLNIKSVAERRENMLWFKVPQKIYFKYGCLRFALKELKDMNKKRA
FIVTDKDLFKLGYVNKITKVLDEIDIKYSIFTDIKSDPTIDSVKKGAKEMLNFEPDTIIS
IGGGSPMDAAKVMHLLYEYPEAEIENLAINFMDIRKRICNFPKLGTKAISVAIPTTAGTG
SEATPFAVITNDETGMKYPLTSYELTPNMAIIDTELMLNMPRKLTAATGIDALVHAIEAY
VSVMATDYTDELALRAIKMIFKYLPRAYKNGTNDIEAREKMAHASNIAGMAFANAFLGVC
HSMAHKLGAMHHVPHGIACAVLIEEVIKYNATDCPTKQTAFPQYKSPNAKRKYAEIAEYL
NLKGTSDTEKVTALIEAISKLKIDLSIPQNISAAGINKKDFYNTLDKMSELAFDDQCTTA
NPRYPLISELKDIYIKSF
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacaaatcaaaaagaactaaaacaaaagctaaatgaattgagagaagcgcaa
aagaagtttgcaacctatactcaagagcaagttgataaaatttttaaacaatgtgccata
gccgcagctaaagaaagaataaacttagctaaattagcagtagaagaaacaggaataggt
cttgtagaagataaaattataaaaaatcattttgcagcagaatatatatacaataaatat
aaaaatgaaaaaacttgtggcataatagaccatgacgattctttaggcataacaaaggtt
gctgaaccaattggaattgttgcagccatagttcctactactaatccaacttccacagca
attttcaaatcattaatttctttaaaaacaagaaacgcaatattcttttcaccacatcca
cgtgcaaaaaaatctacaattgctgcagcaaaattaattttagatgcagctgttaaagca
ggagcacctaaaaatataataggctggatagatgagccatcaatagaactttctcaagat
ttgatgagtgaagctgatataatattagcaacaggaggtccttcaatggttaaagcggcc
tattcatctggaaaacctgcaattggtgttggagcaggaaatacaccagcaataatagat
gagagtgcagatatagatatggcagtaagctccataattttatcaaagacttatgacaat
ggagtaatatgcgcttctgaacaatcaatattagttatgaattcaatatacgaaaaagtt
aaagaggaatttgtaaaacgaggatcatatatactcaatcaaaatgaaatagctaaaata
aaagaaactatgtttaaaaatggagctattaatgctgacatagttggaaaatctgcttat
ataattgctaaaatggcaggaattgaagttcctcaaactacaaagatacttataggcgaa
gtacaatctgttgaaaaaagcgagctgttctcacatgaaaaactatcaccagtacttgca
atgtataaagttaaggattttgatgaagctctaaaaaaggcacaaaggctaatagaatta
ggtggaagtggacacacgtcatctttatatatagattcacaaaacaataaggataaagtt
aaagaatttggattagcaatgaaaacttcaaggacatttattaacatgccttcttcacag
ggagcaagcggagatttatacaattttgcgatagcaccatcatttactcttggatgcggc
acttggggaggaaactctgtatcgcaaaatgtagagcctaaacatttattaaatattaaa
agtgttgctgaaagaagggaaaatatgctttggtttaaagtgccacaaaaaatatatttt
aaatatggatgtcttagatttgcattaaaagaattaaaagatatgaataagaaaagagcc
tttatagtaacagataaagatctttttaaacttggatatgttaataaaataacaaaggta
ctagatgagatagatattaaatacagtatatttacagatattaaatctgatccaactatt
gattcagtaaaaaaaggtgctaaagaaatgcttaactttgaacctgatactataatctct
attggtggtggatcgccaatggatgcagcaaaggttatgcacttgttatatgaatatcca
gaagcagaaattgaaaatctagctataaactttatggatataagaaagagaatatgcaat
ttccctaaattaggtacaaaggcgatttcagtagctattcctacaactgctggtaccggt
tcagaggcaacaccttttgcagttataactaatgatgaaacaggaatgaaatacccttta
acttcttatgaattgaccccaaacatggcaataatagatactgaattaatgttaaatatg
cctagaaaattaacagcagcaactggaatagatgcattagttcatgctatagaagcatat
gtttcggttatggctacggattatactgatgaattagccttaagagcaataaaaatgata
tttaaatatttgcctagagcctataaaaatgggactaacgacattgaagcaagagaaaaa
atggcacatgcctctaatattgcggggatggcatttgcaaatgctttcttaggtgtatgc
cattcaatggctcataaacttggggcaatgcatcacgttccacatggaattgcttgtgct
gtattaatagaagaagttattaaatataacgctacagactgtccaacaaagcaaacagca
ttccctcaatataaatctcctaatgctaagagaaaatatgctgaaattgcagagtatttg
aatttaaagggtactagcgataccgaaaaggtaacagccttaatagaagctatttcaaag
ttaaagatagatttgagtattccacaaaatataagtgccgctggaataaataaaaaagat
ttttataatacgctagataaaatgtcagagcttgcttttgatgaccaatgtacaacagct
aatcctaggtatccacttataagtgaacttaaggatatctatataaaatcattttaa

DBGET integrated database retrieval system