KEGG   Clostridium acetobutylicum ATCC 824: CA_P0162Help
Entry
CA_P0162          CDS       T00056                                 

Gene name
adhe1
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CA_P0162 (adhe1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_P0162 (adhe1)
   00620 Pyruvate metabolism
    CA_P0162 (adhe1)
   00650 Butanoate metabolism
    CA_P0162 (adhe1)
  Lipid metabolism
   00071 Fatty acid degradation
    CA_P0162 (adhe1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CA_P0162 (adhe1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CA_P0162 (adhe1)
   00626 Naphthalene degradation
    CA_P0162 (adhe1)
Enzymes [BR:cac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CA_P0162 (adhe1)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CA_P0162 (adhe1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSOL1:175810..178398
Genome map
AA seq 862 aa AA seqDB search
MKVTTVKELDEKLKVIKEAQKKFSCYSQEMVDEIFRNAAMAAIDARIELAKAAVLETGMG
LVEDKVIKNHFAGEYIYNKYKDEKTCGIIERNEPYGITKIAEPIGVVAAIIPVTNPTSTT
IFKSLISLKTRNGIFFSPHPRAKKSTILAAKTILDAAVKSGAPENIIGWIDEPSIELTQY
LMQKADITLATGGPSLVKSAYSSGKPAIGVGPGNTPVIIDESAHIKMAVSSIILSKTYDN
GVICASEQSVIVLKSIYNKVKDEFQERGAYIIKKNELDKVREVIFKDGSVNPKIVGQSAY
TIAAMAGIKVPKTTRILIGEVTSLGEEEPFAHEKLSPVLAMYEADNFDDALKKAVTLINL
GGLGHTSGIYADEIKARDKIDRFSSAMKTVRTFVNIPTSQGASGDLYNFRIPPSFTLGCG
FWGGNSVSENVGPKHLLNIKTVAERRENMLWFRVPHKVYFKFGCLQFALKDLKDLKKKRA
FIVTDSDPYNLNYVDSIIKILEHLDIDFKVFNKVGREADLKTIKKATEEMSSFMPDTIIA
LGGTPEMSSAKLMWVLYEHPEVKFEDLAIKFMDIRKRIYTFPKLGKKAMLVAITTSAGSG
SEVTPFALVTDNNTGNKYMLADYEMTPNMAIVDAELMMKMPKGLTAYSGIDALVNSIEAY
TSVYASEYTNGLALEAIRLIFKYLPEAYKNGRTNEKAREKMAHASTMAGMASANAFLGLC
HSMAIKLSSEHNIPSGIANALLIEEVIKFNAVDNPVKQAPCPQYKYPNTIFRYARIADYI
KLGGNTDEEKVDLLINKIHELKKALNIPTSIKDAGVLEENFYSSLDRISELALDDQCTGA
NPRFPLTSEIKEMYINCFKKQP
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcacaacagtaaaggaattagatgaaaaactcaaggtaattaaagaagctcaa
aaaaaattctcttgttactcgcaagaaatggttgatgaaatctttagaaatgcagcaatg
gcagcaatcgacgcaaggatagagctagcaaaagcagctgttttggaaaccggtatgggc
ttagttgaagacaaggttataaaaaatcattttgcaggcgaatacatctataacaaatat
aaggatgaaaaaacctgcggtataattgaacgaaatgaaccctacggaattacaaaaata
gcagaacctataggagttgtagctgctataatccctgtaacaaaccccacatcaacaaca
atatttaaatccttaatatcccttaaaactagaaatggaattttcttttcgcctcaccca
agggcaaaaaaatccacaatactagcagctaaaacaatacttgatgcagccgttaagagt
ggtgccccggaaaatataataggttggatagatgaaccttcaattgaactaactcaatat
ttaatgcaaaaagcagatataacccttgcaactggtggtccctcactagttaaatctgct
tattcttccggaaaaccagcaataggtgttggtccgggtaacaccccagtaataattgat
gaatctgctcatataaaaatggcagtaagttcaattatattatccaaaacctatgataat
ggtgttatatgtgcttctgaacaatctgtaatagtcttaaaatccatatataacaaggta
aaagatgagttccaagaaagaggagcttatataataaagaaaaacgaattggataaagtc
cgtgaagtgatttttaaagatggatccgtaaaccctaaaatagtcggacagtcagcttat
actatagcagctatggctggcataaaagtacctaaaaccacaagaatattaataggagaa
gttacctccttaggtgaagaagaaccttttgcccacgaaaaactatctcctgttttggct
atgtatgaggctgacaattttgatgatgctttaaaaaaagcagtaactctaataaactta
ggaggcctcggccatacctcaggaatatatgcagatgaaataaaagcacgagataaaata
gatagatttagtagtgccatgaaaaccgtaagaacctttgtaaatatcccaacctcacaa
ggtgcaagtggagatctatataattttagaataccaccttctttcacgcttggctgcgga
ttttggggaggaaattctgtttccgagaatgttggtccaaaacatcttttgaatattaaa
accgtagctgaaaggagagaaaacatgctttggtttagagttccacataaagtatatttt
aagttcggttgtcttcaatttgctttaaaagatttaaaagatctaaagaaaaaaagagcc
tttatagttactgatagtgacccctataatttaaactatgttgattcaataataaaaata
cttgagcacctagatattgattttaaagtatttaataaggttggaagagaagctgatctt
aaaaccataaaaaaagcaactgaagaaatgtcctcctttatgccagacactataatagct
ttaggtggtacccctgaaatgagctctgcaaagctaatgtgggtactatatgaacatcca
gaagtaaaatttgaagatcttgcaataaaatttatggacataagaaagagaatatatact
ttcccaaaactcggtaaaaaggctatgttagttgcaattacaacttctgctggttccggt
tctgaggttactccttttgctttagtaactgacaataacactggaaataagtacatgtta
gcagattatgaaatgacaccaaatatggcaattgtagatgcagaacttatgatgaaaatg
ccaaagggattaaccgcttattcaggtatagatgcactagtaaatagtatagaagcatac
acatccgtatatgcttcagaatacacaaacggactagcactagaggcaatacgattaata
tttaaatatttgcctgaggcttacaaaaacggaagaaccaatgaaaaagcaagagagaaa
atggctcacgcttcaactatggcaggtatggcatccgctaatgcatttctaggtctatgt
cattccatggcaataaaattaagttcagaacacaatattcctagtggcattgccaatgca
ttactaatagaagaagtaataaaatttaacgcagttgataatcctgtaaaacaagcccct
tgcccacaatataagtatccaaacaccatatttagatatgctcgaattgcagattatata
aagcttggaggaaatactgatgaggaaaaggtagatctcttaattaacaaaatacatgaa
ctaaaaaaagctttaaatataccaacttcaataaaggatgcaggtgttttggaggaaaac
ttctattcctcccttgatagaatatctgaacttgcactagatgatcaatgcacaggcgct
aatcctagatttcctcttacaagtgagataaaagaaatgtatataaattgttttaaaaaa
caaccttaa

DBGET integrated database retrieval system