KEGG   Clostridium acidurici: Curi_c00690Help
Entry
Curi_c00690       CDS       T02255                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cad  Clostridium acidurici
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Curi_c00690 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Curi_c00690 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Curi_c00690 (thrC)
Enzymes [BR:cad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Curi_c00690 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73920..75398
Genome map
AA seq 492 aa AA seqDB search
MSLYYKSTRGDSEKVNSLEAIVKGIANDGGLYVPSYIEKIDMSLNELSKMNYQELAYYII
NKFFPDFSEEELKDCVNSAYDEKFDTKEIAPIVEKSGAYFLELFHGPTLAFKDMALSILP
YLLKTSATKLDYLKEIVILTATSGDTGKAALEGFKDVDGIKIIVYYPENGVSEVQERQMI
TQEGKNTYVVGIKGNFDDAQSGVKEAFNNREFNLDLDSEGYVLSSANSINIGRLVPQVVY
YFHGYIELLRSGKIKEGDKINVVVPTGNFGNILAAFYAKKMGLPINRFICASNENNVLSD
FFKDGVYDRRRELKLTNSPSMDILISSNLERLLYELSGEDDENLKELMDKLSQDGIYEVS
DRIKVGLKDFYGNFATEEETHSAISKVYKGTDYVMDTHTAVAYSVYEKYKDETGDNTPTI
IDSTASPFKFTRSVSDSLGIEIEGKNDFELIKELSNKTGLIIPNSIKDLETREILHKTVC
NKDEIKEAIKKY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatattataaaagtactagaggagacagtgaaaaagtaaattcactagaagca
atagttaaaggtatagcaaatgatggaggtttatatgtaccttcatatatagaaaaaata
gatatgagcttaaatgaattatctaaaatgaactatcaagaattagcatactatattata
aataaattctttccagactttagcgaggaagagcttaaagactgtgtaaatagtgcgtat
gatgaaaaatttgatactaaagaaatagcaccaatagtagaaaagtcaggagcttatttt
ttagagttatttcatggtccaacattagcatttaaggatatggcactttcaatactacct
tatttattaaaaacatcagctacaaaattagactatttaaaagagatagtaatacttaca
gctacttctggagatactgggaaagctgcactagaaggatttaaagatgtagatggaata
aagataatagtttattatccagaaaacggagttagcgaagtgcaagaaagacagatgata
actcaagaaggaaaaaacacttatgtagttggaataaaaggaaactttgatgatgctcaa
agtggagtaaaggaagcctttaacaatagagaatttaatttagatttagatagtgaagga
tatgtattatcttcagcgaattctataaatataggaaggctagttccacaagtggtatat
tacttccacggatatatagagcttttaagaagtggtaagataaaagaaggagataaaata
aacgtagtagttcctacaggaaactttggaaatatattagcagccttttatgctaaaaaa
atgggcttacctataaacagatttatatgtgcatctaatgagaataatgtactatcagac
ttctttaaagatggtgtatatgatagaagaagggaattaaagcttactaattcaccatct
atggatatattgatttcaagtaacttagaaagactattatatgaattaagcggtgaagat
gatgagaatttaaaagaacttatggataaactttcacaagatggtatatatgaagtttcg
gatagaataaaagttggattaaaggatttctatggtaactttgcaacggaagaggaaaca
cacagtgcaatatcaaaagtatacaaaggtacagattatgtaatggatactcatactgcg
gtagcttattctgtatatgaaaaatataaagatgaaacaggagacaatactcctacaata
atagattcgacagcgagtccatttaagttcacaagaagtgttagtgattcattaggaata
gagatagaaggtaagaatgactttgaacttataaaagaactatctaacaagactggacta
ataataccaaattctataaaggatttagaaactagagaaatcttacacaaaacagtttgc
aataaggatgagataaaagaagctataaaaaaatattaa

DBGET integrated database retrieval system