KEGG   Clostridium acidurici: Curi_c01470Help
Entry
Curi_c01470       CDS       T02255                                 

Gene name
speB
Definition
agmatinase SpeB (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cad  Clostridium acidurici
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Curi_c01470 (speB)
Enzymes [BR:cad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Curi_c01470 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144144..144998
Genome map
AA seq 284 aa AA seqDB search
MQKHKNVLTFIGFDSEYEDSEIIVFGAPFDGTTSFRPGARFAPSIMRNESYGLETYSPYL
DKDLEDTKICDVGDLELPLGNTEKTMMVIEEFSKDVLNSNKIPVMIGGEHLVSYPVIKSV
YEKYENLHILHFDAHTDLRDELFGEKLSHATVIRRAWDLVGDNRIHQFGIRSGEREEFKW
AEKHTNLTKFTYEGLDETVTSIGDSPVYVTIDLDILDPSVMSGTGTPEPGGISFNDMMVI
IEKLQRLNIVGADVVELSPHYDQSGASTAVACKVLRELVLAISN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagcataagaatgttttaactttcataggctttgacagtgagtatgaggattct
gaaataatagtatttggagcaccatttgatggcacaacatcatttagaccgggagctaga
tttgctccgagcattatgagaaatgaatcgtatggtttagaaacatatagtccttattta
gataaggatttagaagatacgaaaatatgtgatgttggagacttagaattgcctttaggg
aatacagaaaagacaatgatggttatagaggagttctcaaaagatgtattaaacagtaac
aagatacctgtcatgataggcggagagcatctagtaagctatcctgtaataaagtctgta
tatgaaaaatatgaaaatcttcacatattacactttgatgcacatacagatttaagagat
gaattatttggagaaaagctatctcatgcaacagttataagaagggcttgggatctagtt
ggagataatagaatacatcagttcggaatcagatcaggagagagagaagagtttaagtgg
gcggaaaagcatacaaatttaactaagtttacatacgaggggcttgatgaaacggtaaca
tctataggtgatagccctgtgtatgtgactatagacttagacatattagatccatcagta
atgtcagggacaggaacaccagaacctggaggaataagttttaacgatatgatggttata
atagaaaaattgcaaagactaaatatagtaggagcagatgtagtggaattatcaccccac
tatgatcaaagtggagcatcaacagcagtagcatgtaaagtattaagagaattagtatta
gctataagcaactag

DBGET integrated database retrieval system