KEGG   Gottschalkia acidurici: Curi_c01490Help
Entry
Curi_c01490       CDS       T02255                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cad  Gottschalkia acidurici
Pathway
cad00900  Terpenoid backbone biosynthesis
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Curi_c01490 (ispE)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Curi_c01490 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFS77229
UniProt: K0AVC7
Position
147060..147920
Genome map
AA seq 286 aa AA seqDB search
MRKVKLNAYAKINLSLDVLGKRENGYHELSMIMQQIDLKDIITIEEVNGIQNSIEINSNS
SKVPLDNSNIVYRAWEEISKKYSGNKGVRVSIEKNIPISAGLAGGSTDAAAVLKGLNKLW
SLNLTDAELMDIGLKVGADVPFCIIGGTALAEGIGEKLTKIKSFSNKYILLANPGIEVST
SHVYKNLNLKTIEKRPDINNIIRYIEQSDIYSLSKEMSNVLESVTIKENPIIDEIKQSMI
SNGAVGSLMSGSGATVFGIFDSEEKLENCKKILEKKIDTVICTKTI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtaaaattgaatgcttatgcaaaaataaatctatcactagatgttctagga
aaaagagaaaatgggtatcatgagctttccatgataatgcaacaaatagacttaaaagat
ataataactatcgaggaagtaaacggaatacaaaatagtatagagataaactcaaatagc
tctaaagtaccattagataactcaaatatagtatatagggcatgggaagagatatcaaag
aaatatagtggaaataaaggagtacgtgtaagtatagagaaaaatatacctatatcggca
ggattagccggaggaagtacagatgctgcggcagtattaaagggattaaataaactgtgg
tcactaaatcttacagatgctgaacttatggacataggtttaaaagtaggagctgatgta
ccgttttgtataataggtggaacagcactggcagaaggaataggagaaaaactaacaaaa
ataaaatcattttcgaataagtacatactactagctaatccagggatagaagtttcaact
tcacatgtatataaaaacttgaatttaaaaacaatagagaaaagaccagatataaataac
ataataagatatatagaacaatctgatatatattcactttctaaagaaatgtcaaatgta
ctagagagtgtaactataaaagaaaatcccataatagatgaaataaagcagagtatgatt
tcaaatggagcagtaggtagtttaatgagtggaagtggtgcaactgtatttggaatattc
gatagtgaagaaaagcttgaaaattgtaaaaaaatactagagaaaaaaatagatacagtt
atatgcacaaagacaatttaa

DBGET integrated database retrieval system