KEGG   Clostridium acidurici: Curi_c02360Help
Entry
Curi_c02360       CDS       T02255                                 

Gene name
recD
Definition
RecD/TraA family helicase RecD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cad  Clostridium acidurici
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Curi_c02360 (recD)
Enzymes [BR:cad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Curi_c02360 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243391..245616
Genome map
AA seq 741 aa AA seqDB search
MITLQGDIEEIIFHNEDNGYTVAILGTEDDVVTIVGNIPLIRDGESLKVHGTIINHPTYG
EQLKVEAYELIAPATINGIIKYLSSGLIPGIGPKTAERIVERFGTDSLDILQYNPNRLKE
IEGIGDKKLEKIVASFEEQRELKDIMVFLQQYDITPALGIKIYKKYGTETIEKVQENPYR
LSEEIIGIGFKLADKIAKSMGVEPNSSYRISAGIKFCLTGFASEGHTYAPRQELIHKCSR
LLEVDNTLVEEGLMDLALRQEVQLENFDDEICVYYMPYYYAETNVSKKIIELSQSEIKKL
EVNIENEIEELESENNISLADNQKEAIRQSVENGLLVITGGPGTGKTTTINTIIQLFESQ
DLKIHLAAPTGRAAKRMSEATGREAKTIHRLLEYGFVDESIGMIFSKDEGTPLETDVIII
DEMSMVDILLMNNLLKAIMPGTRVILVGDTDQLPSVGAGNVLKDIIESKIVKVVKLDEIF
RQAQESMIIVNAHKINKGEHPKLNVKDKDFFFLNGQKPEVVVKTVIDLAKERLPKYNGYD
PIKDIQILSCSRKGDVGVNILNDKLQEALNPKARYKSERKIGDQILRVGDKIMQIKNNYN
TKWKLLEGDRITQEGEGVFNGDFGLITDIDEEENELVVLFDDNREVIYNFSQLDEIRLAY
ATTVHKSQGSEFPVVIMPIYWGPPMLLMRNLLYTAITRAKELVVLVGDQKCLGYMINNNK
ITKRYSGLNKRLFKVFEYLMR
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgataacactacagggagatatagaagaaataatatttcataatgaggataatggatac
actgtagccatattaggaacagaagatgatgtagtaactatagtaggaaatatcccttta
atcagagacggagaatcattgaaagtacatggaacaataataaatcaccctacatacgga
gaacagctaaaagtagaagcatatgagctaatagcaccagctacaattaatggaataata
aaatatttatcatcaggtttaataccgggaataggtcctaaaacggcagaaagaatagta
gaaagatttggaacagattcactggacatacttcagtataatcctaataggttaaaagaa
atagagggaatcggggacaaaaagttagaaaagatagtggcatcatttgaagaacaaaga
gaattaaaagatataatggtatttttacaacagtatgatataactccagcattaggaata
aagatatataaaaagtatggtacggagaccatagaaaaagttcaggaaaatccttataga
ttatcagaagaaataataggaataggatttaagttagcagataaaatagcaaaaagcatg
ggtgttgaaccaaactctagttatagaataagtgcgggaattaaattttgtttaactgga
tttgcatcagaaggccatacatatgcaccaaggcaagaactaatacataaatgttcaaga
ttactggaagtagataatacattagttgaagaaggacttatggatttagcattaaggcaa
gaagtacaattagaaaactttgatgatgaaatatgcgtgtactatatgccatactattac
gcagagactaatgtaagcaaaaagataatagaattatcacaaagtgaaataaaaaagtta
gaagtaaatatagaaaatgaaatagaagaactagagagcgaaaataatataagtttagca
gataatcaaaaagaagctattagacaatcagtagaaaacggattattagtaataacagga
ggacctggaacaggtaagaccacgactataaatacaataatacagctatttgaaagtcag
gatttaaaaatacatttagcggcaccaacaggaagagcagctaagagaatgagcgaggct
actggaagagaagctaaaacaatacataggctattagagtatggatttgtggacgagagt
attgggatgatattttcaaaggacgagggaactccgctagaaacagatgtgataataata
gatgaaatgtcaatggtagatatattacttatgaacaatttattaaaggcaattatgcca
ggaactagagtaatattagtgggagatacagatcagttaccatcagtaggagcaggaaat
gtactaaaagatataatagaaagtaaaatagtaaaagtagtaaagttagatgagatcttt
agacaagcacaggaaagcatgataatagtgaatgcacataagataaataagggagaacat
cctaagttgaatgtaaaagataaggacttcttctttctaaatggacaaaaaccggaggtt
gtagtaaaaacggtaatagatttagcgaaggagagacttcctaaatataatggatatgac
ccaataaaagatatacagatactttcatgtagtagaaaaggcgacgtaggggttaatata
ctaaacgataaactacaagaggcattgaatccaaaagcaaggtataaaagtgagagaaaa
ataggtgaccagatactaagagtcggagataagataatgcagataaaaaataactataat
acaaagtggaagttattagagggggataggatcacacaagaaggagaaggcgtatttaat
ggagattttggattaataacagatatagatgaagaagaaaatgaattagtagtattattt
gatgataacagagaagtaatatataattttagtcaattagatgagataagattagcgtat
gcaaccacagttcacaaaagtcaaggtagtgaatttccagtcgtaataatgccaatatat
tggggaccaccaatgctattaatgagaaatctattatatacagcaataactagagcaaag
gaactagtagttttagtgggagatcaaaaatgtttggggtatatgataaataataataaa
ataactaagagatattcagggctcaataagaggttgtttaaagtttttgagtatttaatg
aggtga

DBGET integrated database retrieval system