KEGG   Clostridium acidurici: Curi_c06730Help
Entry
Curi_c06730       CDS       T02255                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase TrpC (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cad  Clostridium acidurici
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cad01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cad00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
759755..760537
Genome map
AA seq 260 aa AA seqDB search
MFILDKIVEVKKKQLEIEKQEISLEEMIEKSKEDRIIRDFEDALDNDDISVISEIKKASP
SRGIIKEDFNPVFTAKIYEESPFNAISVLTEREFFLGDDKYINMVKEVTTKPILRKDFII
DEYQIYQSKVIGADAILLIAAILKGKLKSYYDLAKSLGLHVLVEVHGEDEIEEAIESGCR
LIGINNRNLKTFDVDLKHTEKLIKLLPSDKIVISESGIKGYEDMEYLKYLGVKGVLVGET
LMRNLSNEPKSIILGDILTP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcttagataaaatagttgaggttaaaaagaagcagctagagattgaaaagcaa
gaaattagtctagaagaaatgatagaaaaatctaaggaagatagaattataagagatttt
gaagatgcactagacaatgatgatatatcagttatatctgaaataaaaaaggcatcacct
tctagaggaataataaaagaagattttaacccagtttttacagcaaaaatatatgaagaa
agtccattcaatgctatatcagttttaacagaaagagagttttttctaggtgatgataag
tatataaatatggttaaagaagtaactactaagcctatattaagaaaagactttataata
gatgaatatcaaatatatcaatcaaaggtgataggagcagatgcaatacttttaatagca
gctatattaaaaggaaaacttaaaagctattatgatttagctaaaagtctaggacttcat
gtgttagtagaggttcatggagaagatgaaatagaagaagctatagaaagtggatgtaga
ttaataggaataaacaacagaaatctaaaaacctttgatgtagatttaaagcatactgag
aagctaataaaactactacctagtgataaaatagttatttcagaaagtggaattaagggt
tatgaggatatggaatacttaaaatacttaggagtaaaaggagtacttgtaggagaaaca
cttatgagaaatttaagtaatgaaccaaagtctataattttaggcgatatacttactcca
taa

DBGET integrated database retrieval system