KEGG   Gottschalkia acidurici: Curi_c06750Help
Entry
Curi_c06750       CDS       T02255                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cad  Gottschalkia acidurici
Pathway
cad00260  Glycine, serine and threonine metabolism
cad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cad01100  Metabolic pathways
cad01110  Biosynthesis of secondary metabolites
cad01130  Biosynthesis of antibiotics
cad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Curi_c06750 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Curi_c06750 (trpB)
Enzymes [BR:cad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Curi_c06750 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig Dpoe2NT
Motif
Other DBs
NCBI-ProteinID: AFS77748
UniProt: K0AV60
Position
761214..762416
Genome map
AA seq 400 aa AA seqDB search
MTNTIVKGKFGKFGGQYVAESVMNVLGELEVAFEEAKNDQSFADEFNYYMKDYVGRENPL
YYAENLSKKYGKAKIYLKREDLNHTGAHKINNAIGQVLLAKRMGKKRIIAETGAGQHGVA
TATAAALFGMECEIFMGEEDTKRQALNVFKMEALGAKVNSVTTGSKTLADAVDAALQDWV
ENIDTTFYILGSAVGPHPYPTIVKYFQSIISKEAKKQILEKENRLPDYVVACVGGGSNAI
GMFSEFIEDEEVKLIGVEPAGLGLDTDKHAATMTKGSVGILHGMKTYVLQDEDGQILPVH
SISAGLDYPGVGPEHSHLKDIGRAEYVSVTDDESVDALMELTKVEGIIPAIESAHAVAHV
LKLAKSLEEEKIIIISLSGRGDKDIARIARLKGVNVTDEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacgatagttaagggtaagtttggaaaattcggaggacaatatgtagcagaa
tcagtaatgaatgttttaggagaattagaggtagcatttgaggaagctaagaacgaccaa
agctttgcagatgaatttaattactatatgaaagattatgtaggaagagaaaatccatta
tactatgcagaaaatctttcaaaaaaatatggaaaagcaaaaatatacttaaaaagagaa
gatttaaaccatacaggagcacacaaaataaataacgctataggtcaagtacttctagct
aaaagaatgggtaaaaaaagaataatcgcagaaacaggagcaggtcaacatggagttgca
acagctacagcggcagcactatttggtatggaatgtgaaatatttatgggagaagaagat
acaaaaagacaggcacttaacgtatttaaaatggaagctctaggagctaaagttaactct
gtaactacaggaagtaaaactctagcagatgctgtagacgcagcattacaagattgggta
gaaaatatagatactacattctatatcttaggttcagcagtaggaccacatccatatcca
actatagtgaaatacttccaaagtattatctctaaagaagctaaaaaacaaatattagag
aaagaaaacagattaccagactatgtagtagcttgtgtaggtggaggaagtaatgctatt
ggaatgtttagtgaatttatagaagatgaagaagtaaaattaataggggtagaaccagca
ggtcttggattagacactgataaacatgcagctacaatgacaaaaggaagtgttggaata
ttacacggaatgaagacatacgtacttcaagatgaagatggtcaaatattaccagtacac
tctatatcagcaggattagactatccaggagtaggacctgagcattctcacttaaaagat
atcggaagagcagaatatgttagcgtaacagatgatgaatcagttgatgctcttatggaa
ttaactaaagtagaaggtataataccagctattgaaagtgcgcatgcagtagcacatgta
ttaaaacttgcaaaatcattagaagaagaaaagataataataatctcactttcaggtaga
ggagataaagatatagctagaatagcaagattaaagggagtaaatgtaacagacgaagaa
taa

DBGET integrated database retrieval system