KEGG   Clostridium acidurici: Curi_c06750Help
Entry
Curi_c06750       CDS       T02255                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cad  Clostridium acidurici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Curi_c06750 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Curi_c06750 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Curi_c06750 (trpB)
Enzymes [BR:cad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Curi_c06750 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
761214..762416
Genome map
AA seq 400 aa AA seqDB search
MTNTIVKGKFGKFGGQYVAESVMNVLGELEVAFEEAKNDQSFADEFNYYMKDYVGRENPL
YYAENLSKKYGKAKIYLKREDLNHTGAHKINNAIGQVLLAKRMGKKRIIAETGAGQHGVA
TATAAALFGMECEIFMGEEDTKRQALNVFKMEALGAKVNSVTTGSKTLADAVDAALQDWV
ENIDTTFYILGSAVGPHPYPTIVKYFQSIISKEAKKQILEKENRLPDYVVACVGGGSNAI
GMFSEFIEDEEVKLIGVEPAGLGLDTDKHAATMTKGSVGILHGMKTYVLQDEDGQILPVH
SISAGLDYPGVGPEHSHLKDIGRAEYVSVTDDESVDALMELTKVEGIIPAIESAHAVAHV
LKLAKSLEEEKIIIISLSGRGDKDIARIARLKGVNVTDEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacgatagttaagggtaagtttggaaaattcggaggacaatatgtagcagaa
tcagtaatgaatgttttaggagaattagaggtagcatttgaggaagctaagaacgaccaa
agctttgcagatgaatttaattactatatgaaagattatgtaggaagagaaaatccatta
tactatgcagaaaatctttcaaaaaaatatggaaaagcaaaaatatacttaaaaagagaa
gatttaaaccatacaggagcacacaaaataaataacgctataggtcaagtacttctagct
aaaagaatgggtaaaaaaagaataatcgcagaaacaggagcaggtcaacatggagttgca
acagctacagcggcagcactatttggtatggaatgtgaaatatttatgggagaagaagat
acaaaaagacaggcacttaacgtatttaaaatggaagctctaggagctaaagttaactct
gtaactacaggaagtaaaactctagcagatgctgtagacgcagcattacaagattgggta
gaaaatatagatactacattctatatcttaggttcagcagtaggaccacatccatatcca
actatagtgaaatacttccaaagtattatctctaaagaagctaaaaaacaaatattagag
aaagaaaacagattaccagactatgtagtagcttgtgtaggtggaggaagtaatgctatt
ggaatgtttagtgaatttatagaagatgaagaagtaaaattaataggggtagaaccagca
ggtcttggattagacactgataaacatgcagctacaatgacaaaaggaagtgttggaata
ttacacggaatgaagacatacgtacttcaagatgaagatggtcaaatattaccagtacac
tctatatcagcaggattagactatccaggagtaggacctgagcattctcacttaaaagat
atcggaagagcagaatatgttagcgtaacagatgatgaatcagttgatgctcttatggaa
ttaactaaagtagaaggtataataccagctattgaaagtgcgcatgcagtagcacatgta
ttaaaacttgcaaaatcattagaagaagaaaagataataataatctcactttcaggtaga
ggagataaagatatagctagaatagcaagattaaagggagtaaatgtaacagacgaagaa
taa

DBGET integrated database retrieval system