KEGG   Clostridium acidurici: Curi_c06760Help
Entry
Curi_c06760       CDS       T02255                                 

Gene name
trpA
Definition
TspO and MBR-like proteins (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cad  Clostridium acidurici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cad01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cad00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cad00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762564..763364
Genome map
AA seq 266 aa AA seqDB search
MLNRLDKRFKDLKERNEKALITFITSGVPDLETTEELVLEMEKAGADVVELGIPYSRPIA
DGKIIAEASKRALENGIKTSKVMEMVKNLREKTELPLVYLVYFNTVFAYGVDRFLSKCNE
VGIDGIIIPDLPIEERDEVLEACKENYVHLIPLVAPTSKDRIKEITEGTGGFVYCVAVNG
VTGTRDSINENIQEYMDTVSKFTDTPKAIGFGISSPEMAKEYKDYSDGVIVGSAIVRKIL
EGNSREEIVKSISSFVKELKDAVLDK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaatagattagataaaagatttaaggatttaaaggaaagaaatgaaaaagctctt
attacatttataactagtggagttccagatcttgaaactacagaagaactagttctcgaa
atggaaaaggcaggagcagatgtagtggaacttggtattccatattctcgccctatagct
gacggtaaaattatagcagaagcatctaaaagagctttagaaaacggaattaagacatct
aaagttatggaaatggtaaagaatttaagagagaaaacagaattaccactagtttaccta
gtatattttaatactgtatttgcttacggtgtagatagatttctaagtaaatgcaatgag
gtaggaatagatggaataatcatacctgatcttccgatagaagaaagggatgaagtgcta
gaagcttgtaaagaaaactatgttcacttaataccgttagtagcacctacatctaaagat
agaataaaagaaataactgaaggtacaggtggatttgtttactgtgtagcagtgaatggg
gttactggaactagagatagtataaatgaaaatattcaagaatatatggacacggtatca
aaatttacagacacaccaaaagctataggatttggtatatcaagtccagaaatggctaag
gagtataaggactactcagatggagtaatagtaggaagtgcaatagttagaaaaatacta
gagggaaatagtagagaagagatagtgaaaagtataagcagttttgtaaaagaattaaaa
gatgctgtattagataaatag

DBGET integrated database retrieval system