KEGG   Clostridium acidurici: Curi_c06760Help
Entry
Curi_c06760       CDS       T02255                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cad  Clostridium acidurici
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Curi_c06760 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Curi_c06760 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Curi_c06760 (trpA)
Enzymes [BR:cad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Curi_c06760 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
762564..763364
Genome map
AA seq 266 aa AA seqDB search
MLNRLDKRFKDLKERNEKALITFITSGVPDLETTEELVLEMEKAGADVVELGIPYSRPIA
DGKIIAEASKRALENGIKTSKVMEMVKNLREKTELPLVYLVYFNTVFAYGVDRFLSKCNE
VGIDGIIIPDLPIEERDEVLEACKENYVHLIPLVAPTSKDRIKEITEGTGGFVYCVAVNG
VTGTRDSINENIQEYMDTVSKFTDTPKAIGFGISSPEMAKEYKDYSDGVIVGSAIVRKIL
EGNSREEIVKSISSFVKELKDAVLDK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaatagattagataaaagatttaaggatttaaaggaaagaaatgaaaaagctctt
attacatttataactagtggagttccagatcttgaaactacagaagaactagttctcgaa
atggaaaaggcaggagcagatgtagtggaacttggtattccatattctcgccctatagct
gacggtaaaattatagcagaagcatctaaaagagctttagaaaacggaattaagacatct
aaagttatggaaatggtaaagaatttaagagagaaaacagaattaccactagtttaccta
gtatattttaatactgtatttgcttacggtgtagatagatttctaagtaaatgcaatgag
gtaggaatagatggaataatcatacctgatcttccgatagaagaaagggatgaagtgcta
gaagcttgtaaagaaaactatgttcacttaataccgttagtagcacctacatctaaagat
agaataaaagaaataactgaaggtacaggtggatttgtttactgtgtagcagtgaatggg
gttactggaactagagatagtataaatgaaaatattcaagaatatatggacacggtatca
aaatttacagacacaccaaaagctataggatttggtatatcaagtccagaaatggctaag
gagtataaggactactcagatggagtaatagtaggaagtgcaatagttagaaaaatacta
gagggaaatagtagagaagagatagtgaaaagtataagcagttttgtaaaagaattaaaa
gatgctgtattagataaatag

DBGET integrated database retrieval system