KEGG   Gottschalkia acidurici: Curi_c08350Help
Entry
Curi_c08350       CDS       T02255                                 

Gene name
murE1
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cad  Gottschalkia acidurici
Pathway
cad00300  Lysine biosynthesis
cad00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Curi_c08350 (murE1)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Curi_c08350 (murE1)
Enzymes [BR:cad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Curi_c08350 (murE1)
Peptidoglycan biosynthesis and degradation proteins [BR:cad01011]
 Precursor biosynthesis
  Amino acid ligase
   Curi_c08350 (murE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Phage_sheath_1 Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFS77908
UniProt: K0AVP1
Position
946483..947658
Genome map
AA seq 391 aa AA seqDB search
MKNESNVYRKLDSTKIIGIIGSDDKIITAYILEEILRNAGYRTGLISKSNILVDGKNYII
SERDREQFKINNIVKNMKHENIDVIIIEIQSSQIKALCEENLEIDILIHTNTMLDEYKND
RYLEDKIKLISSLEDSKIAIINIDDDNSIRLIEKNKDIIVISYGLNGKSSITASSLSLDK
VSKFNLCLQRGITTACGNKIDPLEFPISSNLLGRDSMYNTLAAIGACLYLDISLDTISRT
LLNTEGIHRMLKKIYDKEFIVIDCFADSPSNYESALYTIQSLDYNKLIIVNSISDEKSKE
VNDKIANIIIEWKDILNLEMVLFASNEDNEKTADYYGKMFKDNNIKCKTYRSLEDSIKEG
LNNIKSDDIFLLLGGKDMDNGKEIIRLQKLI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaatctaatgtctatagaaaactagatagtacaaagataatcggaataata
ggaagtgatgacaaaattataacggcatatattcttgaggagatattaagaaatgcagga
tatagaactggactaataagtaaatcaaatatattagttgatggtaaaaactatattatc
agtgaaagagatagagaacaatttaaaataaataacatagtaaaaaatatgaagcatgaa
aatatagatgtaattataatagaaattcaatcatcacaaataaaagcactatgtgaagaa
aatttagaaatagatattttgattcatacaaatacaatgttagatgaatataaaaatgac
agatatctagaagataaaattaaattaatcagttctctagaagatagtaaaatagcaata
ataaatatagatgatgataactccataaggttaattgaaaaaaataaagatataatagtt
ataagctatggacttaacggaaaatcgagtataacagcttcaagtttatcattggataaa
gtaagtaaatttaacctatgtttacaaagaggaataactacagcatgtgggaataaaatt
gatccattagagtttcctatatcttcaaatttattgggtagagatagtatgtataataca
ttagcagctataggtgcgtgtctttatcttgatataagtttagatactatatctaggact
cttttaaacactgaagggattcataggatgctaaaaaagatatatgataaagaatttata
gtaatagactgttttgctgattctccatctaattatgaaagtgcactttatactatacaa
agcttagactataataagttgataatagtaaactctatatcagatgagaaaagcaaagaa
gtaaatgataaaatagcaaatataattattgaatggaaagatatattaaacttggagatg
gtactatttgcttctaatgaagataatgagaagacagcagattactatggaaaaatgttt
aaagacaataatataaaatgtaaaacatatagaagtctagaagatagcataaaagaggga
ttaaataatataaaatcagatgatatatttctactattaggtggaaaagacatggataat
ggaaaagaaatcataagactacagaagttaatatag

DBGET integrated database retrieval system