KEGG   Clostridium acidurici: Curi_c08350Help
Entry
Curi_c08350       CDS       T02255                                 

Gene name
murE1
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cad  Clostridium acidurici
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cad00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cad00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
946483..947658
Genome map
AA seq 391 aa AA seqDB search
MKNESNVYRKLDSTKIIGIIGSDDKIITAYILEEILRNAGYRTGLISKSNILVDGKNYII
SERDREQFKINNIVKNMKHENIDVIIIEIQSSQIKALCEENLEIDILIHTNTMLDEYKND
RYLEDKIKLISSLEDSKIAIINIDDDNSIRLIEKNKDIIVISYGLNGKSSITASSLSLDK
VSKFNLCLQRGITTACGNKIDPLEFPISSNLLGRDSMYNTLAAIGACLYLDISLDTISRT
LLNTEGIHRMLKKIYDKEFIVIDCFADSPSNYESALYTIQSLDYNKLIIVNSISDEKSKE
VNDKIANIIIEWKDILNLEMVLFASNEDNEKTADYYGKMFKDNNIKCKTYRSLEDSIKEG
LNNIKSDDIFLLLGGKDMDNGKEIIRLQKLI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaatctaatgtctatagaaaactagatagtacaaagataatcggaataata
ggaagtgatgacaaaattataacggcatatattcttgaggagatattaagaaatgcagga
tatagaactggactaataagtaaatcaaatatattagttgatggtaaaaactatattatc
agtgaaagagatagagaacaatttaaaataaataacatagtaaaaaatatgaagcatgaa
aatatagatgtaattataatagaaattcaatcatcacaaataaaagcactatgtgaagaa
aatttagaaatagatattttgattcatacaaatacaatgttagatgaatataaaaatgac
agatatctagaagataaaattaaattaatcagttctctagaagatagtaaaatagcaata
ataaatatagatgatgataactccataaggttaattgaaaaaaataaagatataatagtt
ataagctatggacttaacggaaaatcgagtataacagcttcaagtttatcattggataaa
gtaagtaaatttaacctatgtttacaaagaggaataactacagcatgtgggaataaaatt
gatccattagagtttcctatatcttcaaatttattgggtagagatagtatgtataataca
ttagcagctataggtgcgtgtctttatcttgatataagtttagatactatatctaggact
cttttaaacactgaagggattcataggatgctaaaaaagatatatgataaagaatttata
gtaatagactgttttgctgattctccatctaattatgaaagtgcactttatactatacaa
agcttagactataataagttgataatagtaaactctatatcagatgagaaaagcaaagaa
gtaaatgataaaatagcaaatataattattgaatggaaagatatattaaacttggagatg
gtactatttgcttctaatgaagataatgagaagacagcagattactatggaaaaatgttt
aaagacaataatataaaatgtaaaacatatagaagtctagaagatagcataaaagaggga
ttaaataatataaaatcagatgatatatttctactattaggtggaaaagacatggataat
ggaaaagaaatcataagactacagaagttaatatag

DBGET integrated database retrieval system