KEGG   Clostridium acidurici: Curi_c08430Help
Entry
Curi_c08430       CDS       T02255                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cad  Clostridium acidurici
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cad00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Curi_c08430 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Curi_c08430 (cheB1)
Enzymes [BR:cad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Curi_c08430 (cheB1)
Two-component system [BR:cad02022]
 CheA family
  CheA-CheYBV
   Curi_c08430 (cheB1)
Bacterial motility proteins [BR:cad02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Curi_c08430 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956640..957656
Genome map
AA seq 338 aa AA seqDB search
MARKIKVLVVDDSFMFREVVSMGISQDPLIDVVATATDPYIARDKIIEFEPDVITLDIDM
PRMNGIEFLKKLMPQYPIPVIVVSAIDSGVLDALRYGAIDFVTKSDINNRDYFISELIRK
IKIASISKVGYPQEGYVNIESIYDTSNINKNMIIAIGASTGGTEAILKILKDFHKDIPGI
VIVQHMPAKFTKMYADRINNICEIDIKEAEKGDIVTPGKALIAPGGYHMEVKKRGDKYIV
DCFRDEKVNGHRPSVDVLFNSVADCFGKKAVGVILTGMGCDGSKGLLKMKESGAITIAQD
EKTSVVYGMPRVAYQIGATTKVLPIHKISREVYKSVSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaaaataaaagtacttgtagtagatgattcttttatgtttagggaagttgta
tcaatgggaatatcacaagatcccttaatagatgtagtagcaacagctactgatccttat
atagcaagagataaaataatagaatttgaaccagatgttataacattagatatagatatg
cctagaatgaatggaatagaattcttgaaaaaacttatgccgcagtatccaataccagta
atagtagttagtgctatagatagtggggtactcgatgcacttagatatggggctatagat
tttgtaaccaaatctgatattaataatagagattattttataagtgaactcataagaaag
ataaaaatagcatcgatatctaaagtaggatatcctcaagaagggtatgtaaatatagaa
agtatttatgatacgagtaatataaataaaaatatgattatagcaatcggggcatctaca
ggaggaacagaagctattcttaaaatattaaaagacttccataaggatattccaggcata
gtaatagttcagcatatgccagctaaatttacaaaaatgtatgcggacagaataaataac
atatgtgaaatagacataaaagaagctgaaaaaggagatattgtaacccctgggaaagca
ttaattgctccaggaggatatcatatggaagttaagaaaagaggagataaatatatagta
gactgctttagagatgaaaaagtaaatggacacagaccttctgtagatgtactattcaat
tctgtagcagactgttttgggaagaaagctgtaggcgttatactcacaggaatggggtgt
gatggatcaaagggattacttaagatgaaggagtcaggagcaataactatagcccaagat
gagaagacatctgtagtatacggtatgcctagagtagcttatcaaataggtgcaactact
aaagtgttacctattcataaaatatcaagagaagtttataaatcagtaagcaagtaa

DBGET integrated database retrieval system