KEGG   Gottschalkia acidurici: Curi_c10240Help
Entry
Curi_c10240       CDS       T02255                                 

Gene name
malQ
Definition
(GenBank) 4-alpha-glucanotransferase MalQ
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cad  Gottschalkia acidurici
Pathway
cad00500  Starch and sucrose metabolism
cad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Curi_c10240 (malQ)
Enzymes [BR:cad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Curi_c10240 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AFS78038
UniProt: K0AVY0
Position
1106706..1108190
Genome map
AA seq 494 aa AA seqDB search
MKRSSGILMSITSLPNAYGIGTFGKEAYEFVDFLNKSGQSYWQVLPLNPTSFGDSPYQSP
SAFAGNPYFIDFELLERDNLLKKSDYEFIDFGCDEERIDYEKIFKNKMKVLRIAFTNKDE
IEDEDIKKFRKENQYWVEDYALYMALKYKFDLKSWQDWDKDIKIREKEKVNYYKKKLKEE
IDYWIFIQFLFFKQWNNLKDYANRKRIKIIGDVPIYVAEDSADTWANSEIFLLDDNRVPI
VVSGVPPDGFSSDGQLWGNPIYNWDLLEERNFDWWIERLTMNLNLYDVIRIDHFRGFESY
WQVKYGERTAVNGEWVKGPNIRFFKTVYNCLGNIPIIVEDLGYLTKEVLELRDKLGYPGM
KILQFAFDSDENNDYLPHNYDRNCVAYTGTHDNNTVIGWLDNTDRRVLEFCSKYLGLNQE
EGYNWGMIRGTWASIANLSIAQLQDFLSIDSKGRMNIPSKVDGNWQWRLKKEQLTSDLAE
KIYSLTKMYRRIRD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagaagtagtggtatacttatgagtataacatcattaccaaatgcatacgggata
ggaacttttggaaaagaagcctacgaatttgtagattttttaaataaaagtggtcaatct
tattggcaagtattaccactgaatccaactagctttggtgactcaccatatcagagtcct
tcagcttttgctgggaatccatattttatagattttgaactcttagagagggacaattta
ttaaagaaaagtgactatgagtttattgattttggatgtgacgaagaaagaattgattat
gaaaagatatttaaaaataagatgaaagttttaagaatagcttttacaaataaagatgaa
atagaagatgaagatataaaaaagtttagaaaagaaaatcaatactgggtagaagactat
gcactttacatggcacttaaatataagtttgatttaaaatcgtggcaagactgggataaa
gatataaagataagagaaaaagagaaagtgaattattataaaaagaaacttaaagaagag
atagattactggatatttattcagtttttattttttaaacaatggaacaacttaaaagac
tatgccaatagaaaaagaataaagataataggagatgtaccaatatatgtagcagaagac
agtgcagacacttgggcaaatagcgaaatttttttattagatgataacagagttcccata
gttgtatcaggagtcccgccagatggatttagttctgatggacaattatggggtaatcca
atatataattgggacttattagaagaaagaaattttgattggtggatagagagacttact
atgaatcttaatctatatgatgtaataagaatagatcactttagagggtttgagtcttat
tggcaagttaaatacggagaaagaacagcagtaaatggagaatgggttaagggaccaaat
ataaggttttttaaaactgtctataattgcttaggaaatattccaattatagtagaggat
ttaggatatttaactaaagaagtactagaattgagggacaaattaggatatccaggtatg
aagatcctacagtttgcatttgattcagatgaaaacaatgactacttaccacacaactat
gatagaaactgtgtagcatatacgggaacacatgataataatacagtaataggatggctt
gataacactgatagaagagtattagagttttgtagtaaatatttaggactaaatcaagag
gaaggttataactggggaatgataagaggtacttgggcttcaattgcaaacttatcaata
gctcagctacaagattttttatctatagatagtaaaggaagaatgaatataccatctaaa
gttgatggcaattggcaatggagattgaaaaaggaacaactgacaagtgatttagcagaa
aaaatatattctcttaccaaaatgtatagacgaataagagattaa

DBGET integrated database retrieval system